Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	55789
Gene name	DEP domain containing 1B
Gene symbol	DEPDC1B
Synonyms (NCBI Gene)	BRCC3XTP1
Chromosome	5
Chromosome location	5q12.1

166

Show/Hide all (166)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020076	hsa-miR-361-5p	Sequencing	20371350
MIRT564279	hsa-miR-548ac	PAR-CLIP	20371350
MIRT564278	hsa-miR-548bb-3p	PAR-CLIP	20371350
MIRT564277	hsa-miR-548d-3p	PAR-CLIP	20371350
MIRT564276	hsa-miR-548h-3p	PAR-CLIP	20371350
MIRT564275	hsa-miR-548z	PAR-CLIP	20371350
MIRT564274	hsa-miR-548ae-3p	PAR-CLIP	20371350
MIRT564273	hsa-miR-548ah-3p	PAR-CLIP	20371350
MIRT564272	hsa-miR-548aj-3p	PAR-CLIP	20371350
MIRT564271	hsa-miR-548am-3p	PAR-CLIP	20371350
MIRT564270	hsa-miR-548aq-3p	PAR-CLIP	20371350
MIRT564269	hsa-miR-548j-3p	PAR-CLIP	20371350
MIRT564268	hsa-miR-548x-3p	PAR-CLIP	20371350
MIRT564267	hsa-miR-548a-3p	PAR-CLIP	20371350
MIRT564266	hsa-miR-548ar-3p	PAR-CLIP	20371350
MIRT564265	hsa-miR-548az-3p	PAR-CLIP	20371350
MIRT564264	hsa-miR-548e-3p	PAR-CLIP	20371350
MIRT564263	hsa-miR-548f-3p	PAR-CLIP	20371350
MIRT313866	hsa-miR-4282	PAR-CLIP	20371350
MIRT564262	hsa-miR-3617-5p	PAR-CLIP	20371350
MIRT564261	hsa-miR-641	PAR-CLIP	20371350
MIRT564260	hsa-miR-3942-5p	PAR-CLIP	20371350
MIRT564259	hsa-miR-4703-5p	PAR-CLIP	20371350
MIRT564258	hsa-miR-455-5p	PAR-CLIP	20371350
MIRT564257	hsa-miR-95-5p	PAR-CLIP	20371350
MIRT564256	hsa-miR-103a-3p	PAR-CLIP	20371350
MIRT564255	hsa-miR-107	PAR-CLIP	20371350
MIRT564254	hsa-miR-3944-5p	PAR-CLIP	20371350
MIRT564253	hsa-miR-143-5p	PAR-CLIP	20371350
MIRT564279	hsa-miR-548ac	PAR-CLIP	20371350
MIRT564278	hsa-miR-548bb-3p	PAR-CLIP	20371350
MIRT564277	hsa-miR-548d-3p	PAR-CLIP	20371350
MIRT564276	hsa-miR-548h-3p	PAR-CLIP	20371350
MIRT564275	hsa-miR-548z	PAR-CLIP	20371350
MIRT564274	hsa-miR-548ae-3p	PAR-CLIP	20371350
MIRT564273	hsa-miR-548ah-3p	PAR-CLIP	20371350
MIRT564272	hsa-miR-548aj-3p	PAR-CLIP	20371350
MIRT564271	hsa-miR-548am-3p	PAR-CLIP	20371350
MIRT564270	hsa-miR-548aq-3p	PAR-CLIP	20371350
MIRT564269	hsa-miR-548j-3p	PAR-CLIP	20371350
MIRT564268	hsa-miR-548x-3p	PAR-CLIP	20371350
MIRT564267	hsa-miR-548a-3p	PAR-CLIP	20371350
MIRT564266	hsa-miR-548ar-3p	PAR-CLIP	20371350
MIRT564265	hsa-miR-548az-3p	PAR-CLIP	20371350
MIRT564264	hsa-miR-548e-3p	PAR-CLIP	20371350
MIRT564263	hsa-miR-548f-3p	PAR-CLIP	20371350
MIRT313866	hsa-miR-4282	PAR-CLIP	20371350
MIRT564262	hsa-miR-3617-5p	PAR-CLIP	20371350
MIRT564261	hsa-miR-641	PAR-CLIP	20371350
MIRT564260	hsa-miR-3942-5p	PAR-CLIP	20371350
MIRT564259	hsa-miR-4703-5p	PAR-CLIP	20371350
MIRT564258	hsa-miR-455-5p	PAR-CLIP	20371350
MIRT564257	hsa-miR-95-5p	PAR-CLIP	20371350
MIRT564256	hsa-miR-103a-3p	PAR-CLIP	20371350
MIRT564255	hsa-miR-107	PAR-CLIP	20371350
MIRT564254	hsa-miR-3944-5p	PAR-CLIP	20371350
MIRT564253	hsa-miR-143-5p	PAR-CLIP	20371350
MIRT932937	hsa-miR-101	CLIP-seq
MIRT932938	hsa-miR-128	CLIP-seq
MIRT932939	hsa-miR-132	CLIP-seq
MIRT932940	hsa-miR-1912	CLIP-seq
MIRT932941	hsa-miR-194	CLIP-seq
MIRT932942	hsa-miR-199a-5p	CLIP-seq
MIRT932943	hsa-miR-199b-5p	CLIP-seq
MIRT932944	hsa-miR-212	CLIP-seq
MIRT932945	hsa-miR-224	CLIP-seq
MIRT932946	hsa-miR-27a	CLIP-seq
MIRT932947	hsa-miR-27b	CLIP-seq
MIRT932948	hsa-miR-3130-5p	CLIP-seq
MIRT932949	hsa-miR-4482	CLIP-seq
MIRT932950	hsa-miR-4700-3p	CLIP-seq
MIRT932951	hsa-miR-4711-3p	CLIP-seq
MIRT932952	hsa-miR-4768-3p	CLIP-seq
MIRT932953	hsa-miR-539	CLIP-seq
MIRT932954	hsa-miR-802	CLIP-seq
MIRT932937	hsa-miR-101	CLIP-seq
MIRT932955	hsa-miR-1251	CLIP-seq
MIRT932956	hsa-miR-1273d	CLIP-seq
MIRT932938	hsa-miR-128	CLIP-seq
MIRT932957	hsa-miR-1297	CLIP-seq
MIRT932939	hsa-miR-132	CLIP-seq
MIRT932958	hsa-miR-1323	CLIP-seq
MIRT932959	hsa-miR-145	CLIP-seq
MIRT932960	hsa-miR-186	CLIP-seq
MIRT932940	hsa-miR-1912	CLIP-seq
MIRT932941	hsa-miR-194	CLIP-seq
MIRT932942	hsa-miR-199a-5p	CLIP-seq
MIRT932943	hsa-miR-199b-5p	CLIP-seq
MIRT932944	hsa-miR-212	CLIP-seq
MIRT932945	hsa-miR-224	CLIP-seq
MIRT932961	hsa-miR-26a	CLIP-seq
MIRT932962	hsa-miR-26b	CLIP-seq
MIRT932946	hsa-miR-27a	CLIP-seq
MIRT932947	hsa-miR-27b	CLIP-seq
MIRT932963	hsa-miR-29a	CLIP-seq
MIRT932964	hsa-miR-29b	CLIP-seq
MIRT932965	hsa-miR-29c	CLIP-seq
MIRT932948	hsa-miR-3130-5p	CLIP-seq
MIRT932966	hsa-miR-33a	CLIP-seq
MIRT932967	hsa-miR-33b	CLIP-seq
MIRT932968	hsa-miR-3545-5p	CLIP-seq
MIRT932969	hsa-miR-371b-5p	CLIP-seq
MIRT932970	hsa-miR-4257	CLIP-seq
MIRT932971	hsa-miR-4272	CLIP-seq
MIRT932972	hsa-miR-4465	CLIP-seq
MIRT932949	hsa-miR-4482	CLIP-seq
MIRT932973	hsa-miR-4521	CLIP-seq
MIRT932974	hsa-miR-4709-5p	CLIP-seq
MIRT932951	hsa-miR-4711-3p	CLIP-seq
MIRT932975	hsa-miR-4789-5p	CLIP-seq
MIRT932976	hsa-miR-511	CLIP-seq
MIRT932977	hsa-miR-548o	CLIP-seq
MIRT932978	hsa-miR-660	CLIP-seq
MIRT932954	hsa-miR-802	CLIP-seq
MIRT932979	hsa-miR-888	CLIP-seq
MIRT932975	hsa-miR-4789-5p	CLIP-seq
MIRT932937	hsa-miR-101	CLIP-seq
MIRT2211630	hsa-miR-124	CLIP-seq
MIRT2211631	hsa-miR-1265	CLIP-seq
MIRT932938	hsa-miR-128	CLIP-seq
MIRT932957	hsa-miR-1297	CLIP-seq
MIRT932939	hsa-miR-132	CLIP-seq
MIRT932958	hsa-miR-1323	CLIP-seq
MIRT2211632	hsa-miR-142-5p	CLIP-seq
MIRT932940	hsa-miR-1912	CLIP-seq
MIRT932941	hsa-miR-194	CLIP-seq
MIRT2211633	hsa-miR-199a-3p	CLIP-seq
MIRT932942	hsa-miR-199a-5p	CLIP-seq
MIRT2211634	hsa-miR-199b-3p	CLIP-seq
MIRT932943	hsa-miR-199b-5p	CLIP-seq
MIRT932944	hsa-miR-212	CLIP-seq
MIRT932945	hsa-miR-224	CLIP-seq
MIRT2211635	hsa-miR-2392	CLIP-seq
MIRT932961	hsa-miR-26a	CLIP-seq
MIRT932962	hsa-miR-26b	CLIP-seq
MIRT932946	hsa-miR-27a	CLIP-seq
MIRT932947	hsa-miR-27b	CLIP-seq
MIRT2211636	hsa-miR-3074-3p	CLIP-seq
MIRT2211637	hsa-miR-3129-5p	CLIP-seq
MIRT932948	hsa-miR-3130-5p	CLIP-seq
MIRT2211638	hsa-miR-3171	CLIP-seq
MIRT2211639	hsa-miR-340	CLIP-seq
MIRT2211640	hsa-miR-3714	CLIP-seq
MIRT932969	hsa-miR-371b-5p	CLIP-seq
MIRT2211641	hsa-miR-3910	CLIP-seq
MIRT932971	hsa-miR-4272	CLIP-seq
MIRT932972	hsa-miR-4465	CLIP-seq
MIRT2211642	hsa-miR-4474-5p	CLIP-seq
MIRT932949	hsa-miR-4482	CLIP-seq
MIRT932951	hsa-miR-4711-3p	CLIP-seq
MIRT932975	hsa-miR-4789-5p	CLIP-seq
MIRT2211643	hsa-miR-491-3p	CLIP-seq
MIRT2211644	hsa-miR-506	CLIP-seq
MIRT932976	hsa-miR-511	CLIP-seq
MIRT2211645	hsa-miR-548ae	CLIP-seq
MIRT2211646	hsa-miR-548aj	CLIP-seq
MIRT2211647	hsa-miR-548am	CLIP-seq
MIRT932977	hsa-miR-548o	CLIP-seq
MIRT2211648	hsa-miR-548x	CLIP-seq
MIRT932954	hsa-miR-802	CLIP-seq
MIRT932979	hsa-miR-888	CLIP-seq
MIRT2211649	hsa-miR-936	CLIP-seq
MIRT932958	hsa-miR-1323	CLIP-seq
MIRT932969	hsa-miR-371b-5p	CLIP-seq
MIRT932977	hsa-miR-548o	CLIP-seq
MIRT932979	hsa-miR-888	CLIP-seq

Show/Hide all (6)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005096	Function	GTPase activator activity	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0016477	Process	Cell migration	IMP	24971537
GO:0030177	Process	Positive regulation of Wnt signaling pathway	IBA
GO:0030177	Process	Positive regulation of Wnt signaling pathway	IMP	24971537
GO:0035556	Process	Intracellular signal transduction	IEA

MIM	HGNC	e!Ensembl
616073	24902	ENSG00000035499

Q8WUY9

Protein name

DEP domain-containing protein 1B (HBV X-transactivated gene 8 protein) (HBV XAg-transactivated protein 8)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00610	DEP	27 → 106	Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP)	Domain
PF00620	RhoGAP	266 → 346	RhoGAP domain	Domain

Sequence

MEHRIVGPGPYRATRLWNETVELFRAKMPLRKHRCRFKSYEHCFTAAEAVDWLHELLRCS
QNFGPEVTRKQTVQLLKKFLKNHVIEDIKGKWGEEDFEDNRHLYRFPPSSPLKPYPKKPP
NQKDVIKFPEWNDLPPGTSQENIPVRPVVMNSEMWYKRHSIAIGEVPACRLVHRRQLTEA
NVEEIWKSMTLSYLQKILGLDSLEEVLDVKLVNSKFIIHNVYSVSKQGVVILDDKSKELP
HWVLSAMKCLANWPNCSDLKQPMYLGFEKDVFKTIADYYGHLKEPLLTFHLFDAFVSVLG
LLQKEKVAVEAFQICCLLLPPENRRKLQLLMRMMARICLNKEMPPLCDGFGTRTLMVQTF
SRCILCSKDEVDLDELLAARLVTFLMDNYQEILKVPLALQTSIEERVAHLRRVQIKYPGA
DMDITLSAPSFCRQISPEEFEYQRSYGSQEPLAALLEEVITDAKLSNKEKKKKLKQFQKS
YPEVYQERFPTPESAALLFPEKPKPKPQLLMWALKKPFQPFQRTRSFRM

Sequence length

529

Interactions

View interactions

	Reactome
			Rho GTPase cycle

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (27)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	31379917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	29163701		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	37642235	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34983303	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36785674	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	35392038	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	36016512	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	36394729	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	29297565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	25091805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31164201		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	29163701		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	25091805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	29163701		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	25091805, 30880030		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	30880030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	35088579	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	35088579	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	25091805	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30880030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	29163701		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	29163701		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	32664150	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	31825138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	29297565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	29297565		★★★★★ ★☆☆☆☆ Found in Text Mining only

DEPDC1B (DEP domain containing 1B)