Gene Gene information from NCBI Gene database.
Entrez ID 55786
Gene name Zinc finger protein 415
Gene symbol ZNF415
Synonyms (NCBI Gene)
PactZfLp
Chromosome 19
Chromosome location 19q13.42
miRNA miRNA information provided by mirtarbase database.
244
miRTarBase ID miRNA Experiments Reference
MIRT609165 hsa-miR-4789-3p HITS-CLIP 19536157
MIRT609164 hsa-miR-4643 HITS-CLIP 19536157
MIRT609163 hsa-miR-520d-5p HITS-CLIP 19536157
MIRT609162 hsa-miR-524-5p HITS-CLIP 19536157
MIRT609161 hsa-miR-3941 HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
14
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0001650 Component Fibrillar center IDA
GO:0003677 Function DNA binding IEA
GO:0005515 Function Protein binding IPI 25416956, 32296183
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
619506 20636 ENSG00000170954
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q09FC8
Protein name Zinc finger protein 415
Protein function Involved in transcriptional regulation. Transcriptional activity differed among the various isoforms. All isoforms except isoform 3 seem to suppresses the transcriptional activities of AP-1 and p53/TP53.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00096 zf-C2H2 292 314 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 320 342 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 348 370 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 376 398 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 404 426 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 432 454 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 460 482 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 488 510 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 516 538 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 544 566 Zinc finger, C2H2 type Domain
PF00096 zf-C2H2 572 594 Zinc finger, C2H2 type Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in all tissues examined. Isoforms are differentially expressed. Isoform 3 and isoform 5 were highly expressed, isoform 4 moderately expressed, isoform 2 lower expression, the lowest expression level was seem with isoform 1. {
Sequence
MPELYTEDFIQGCDVGELQEPGLPGVLSYVGAQERALDHRKPSTSSKKTKRVEIDQRCEN
RLECNGAISAHCNLRLPDSNDSPASASRVAGITDLSRNCVIKELAPQQEGNPGEVFHTVT
LEQHEKHDIEEFCFREIKKKIHDFDCQWRDDERNCNKVTTAPKENLTCRRDQRDRRGIGN
KSIKHQLGLSFLPHPHELQQFQAEGKIYECNHVEKSVNHGSSVSPPQIISSTIKTHVSNK
YGTDFICSSLLTQEQKSCIREKPYRYIECDKALNHGSHMTVRQVSHSGEKGYKCDLCGKV
FSQKSNLARHWRVH
TGEKPYKCNECDRSFSRNSCLALHRRVHTGEKPYKCYECDKVFSRN
SCLALHQKTH
IGEKPYTCKECGKAFSVRSTLTNHQVIHSGKKPYKCNECGKVFSQTSSLA
THQRIH
TGEKPYKCNECGKVFSQTSSLARHWRIHTGEKPYKCNECGKVFSYNSHLASHRR
VH
TGEKPYKCNECGKAFSVHSNLTTHQVIHTGEKPYKCNQCGKGFSVHSSLTTHQVIHTG
EKPYKCNECGKSFSVRPNLTRHQIIHTGKKPYKCSDCGKSFSVRPNLFRHQIIHTKEKPY
KRN
Sequence length 603
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Generic Transcription Pathway
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
DEMENTIA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenocarcinoma Adenocarcinoma BEFREE 17332367
★☆☆☆☆
Found in Text Mining only
Atrial Fibrillation Atrial Fibrillation BEFREE 28063245, 29379275
★☆☆☆☆
Found in Text Mining only
Autoimmune Diseases Autoimmune Diseases BEFREE 29032202
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma BEFREE 31067223
★☆☆☆☆
Found in Text Mining only
Bronchioloalveolar Adenocarcinoma Lung adenocarcinoma BEFREE 17332367
★☆☆☆☆
Found in Text Mining only
Carcinoma, Ovarian Epithelial Ovarian Epithelial carcinoma BEFREE 30305341
★☆☆☆☆
Found in Text Mining only
Deep Vein Thrombosis Thrombosis BEFREE 28063245, 30607785
★☆☆☆☆
Found in Text Mining only
DYSTONIA 16 (disorder) Dystonia BEFREE 31246344
★☆☆☆☆
Found in Text Mining only
Dystonia Disorders Dystonia BEFREE 26231208
★☆☆☆☆
Found in Text Mining only
Encephalitis Encephalitis BEFREE 29032202
★☆☆☆☆
Found in Text Mining only