Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5578
Gene name	Protein kinase C alpha
Gene symbol	PRKCA
Synonyms (NCBI Gene)	AAG6PKC-alphaPKCAPKCI+/-PKCalphaPRKACA
Chromosome	17
Chromosome location	17q24.2
Summary	Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and the second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs16960228	G>A	Drug-response	Intron variant, genic downstream transcript variant

995

Show/Hide all (995)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006882	mmu-miR-24-2-5p	Luciferase reporter assayqRT-PCRWestern blot	22911661
MIRT020045	hsa-miR-375	Microarray	20215506
MIRT050756	hsa-miR-17-3p	CLASH	23622248
MIRT049636	hsa-miR-92a-3p	CLASH	23622248
MIRT041382	hsa-miR-193b-3p	CLASH	23622248
MIRT040995	hsa-miR-505-3p	CLASH	23622248
MIRT053072	hsa-miR-203a-3p	qRT-PCR	24040137
MIRT614837	hsa-miR-5196-3p	HITS-CLIP	19536157
MIRT614836	hsa-miR-5193	HITS-CLIP	19536157
MIRT614834	hsa-miR-4722-3p	HITS-CLIP	19536157
MIRT614833	hsa-miR-6727-3p	HITS-CLIP	19536157
MIRT614832	hsa-miR-6747-3p	HITS-CLIP	19536157
MIRT614829	hsa-miR-371b-5p	HITS-CLIP	19536157
MIRT614831	hsa-miR-1976	HITS-CLIP	19536157
MIRT614830	hsa-miR-6828-5p	HITS-CLIP	19536157
MIRT700612	hsa-miR-4486	HITS-CLIP	23313552
MIRT700611	hsa-miR-214-5p	HITS-CLIP	23313552
MIRT700610	hsa-miR-6811-3p	HITS-CLIP	23313552
MIRT700609	hsa-miR-6847-3p	HITS-CLIP	23313552
MIRT700608	hsa-miR-4284	HITS-CLIP	23313552
MIRT700607	hsa-miR-24-3p	HITS-CLIP	23313552
MIRT700606	hsa-miR-3652	HITS-CLIP	23313552
MIRT700605	hsa-miR-4430	HITS-CLIP	23313552
MIRT700604	hsa-miR-4505	HITS-CLIP	23313552
MIRT700603	hsa-miR-5787	HITS-CLIP	23313552
MIRT700602	hsa-miR-585-3p	HITS-CLIP	23313552
MIRT700601	hsa-miR-1268a	HITS-CLIP	23313552
MIRT700600	hsa-miR-1268b	HITS-CLIP	23313552
MIRT700599	hsa-miR-7977	HITS-CLIP	23313552
MIRT700598	hsa-miR-6514-3p	HITS-CLIP	23313552
MIRT700597	hsa-miR-647	HITS-CLIP	23313552
MIRT700596	hsa-miR-6842-3p	HITS-CLIP	23313552
MIRT700595	hsa-miR-6821-5p	HITS-CLIP	23313552
MIRT614837	hsa-miR-5196-3p	HITS-CLIP	23824327
MIRT614834	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT614833	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT614832	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT614831	hsa-miR-1976	HITS-CLIP	23824327
MIRT614830	hsa-miR-6828-5p	HITS-CLIP	23824327
MIRT614829	hsa-miR-371b-5p	HITS-CLIP	23824327
MIRT614836	hsa-miR-5193	HITS-CLIP	23824327
MIRT614835	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT614834	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT614833	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT614832	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT614831	hsa-miR-1976	HITS-CLIP	23824327
MIRT614830	hsa-miR-6828-5p	HITS-CLIP	23824327
MIRT614829	hsa-miR-371b-5p	HITS-CLIP	23824327
MIRT614834	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT614833	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT614832	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT614829	hsa-miR-371b-5p	HITS-CLIP	23824327
MIRT614831	hsa-miR-1976	HITS-CLIP	23824327
MIRT614837	hsa-miR-5196-3p	HITS-CLIP	23824327
MIRT614836	hsa-miR-5193	HITS-CLIP	23824327
MIRT614835	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT614834	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT614833	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT614832	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT614831	hsa-miR-1976	HITS-CLIP	23824327
MIRT614830	hsa-miR-6828-5p	HITS-CLIP	23824327
MIRT614829	hsa-miR-371b-5p	HITS-CLIP	23824327
MIRT614836	hsa-miR-5193	HITS-CLIP	23824327
MIRT614835	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT614834	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT614833	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT614832	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT614831	hsa-miR-1976	HITS-CLIP	23824327
MIRT614830	hsa-miR-6828-5p	HITS-CLIP	23824327
MIRT614829	hsa-miR-371b-5p	HITS-CLIP	23824327
MIRT614837	hsa-miR-5196-3p	HITS-CLIP	23824327
MIRT614836	hsa-miR-5193	HITS-CLIP	23824327
MIRT614835	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT614834	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT614833	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT614832	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT614831	hsa-miR-1976	HITS-CLIP	23824327
MIRT614830	hsa-miR-6828-5p	HITS-CLIP	23824327
MIRT614829	hsa-miR-371b-5p	HITS-CLIP	23824327
MIRT439901	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439901	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT614831	hsa-miR-1976	HITS-CLIP	28735896
MIRT614831	hsa-miR-1976	HITS-CLIP	28735896
MIRT614831	hsa-miR-1976	HITS-CLIP	28735896
MIRT614831	hsa-miR-1976	HITS-CLIP	28735896
MIRT614831	hsa-miR-1976	HITS-CLIP	28735896
MIRT614831	hsa-miR-1976	HITS-CLIP	28735896
MIRT614831	hsa-miR-1976	HITS-CLIP	28735896
MIRT614829	hsa-miR-371b-5p	HITS-CLIP	28735896
MIRT614829	hsa-miR-371b-5p	HITS-CLIP	28735896
MIRT614829	hsa-miR-371b-5p	HITS-CLIP	28735896
MIRT614829	hsa-miR-371b-5p	HITS-CLIP	28735896
MIRT614829	hsa-miR-371b-5p	HITS-CLIP	28735896
MIRT614829	hsa-miR-371b-5p	HITS-CLIP	28735896
MIRT614829	hsa-miR-371b-5p	HITS-CLIP	28735896
MIRT614834	hsa-miR-4722-3p	HITS-CLIP	28735896
MIRT614834	hsa-miR-4722-3p	HITS-CLIP	28735896
MIRT614834	hsa-miR-4722-3p	HITS-CLIP	28735896
MIRT614834	hsa-miR-4722-3p	HITS-CLIP	28735896
MIRT614834	hsa-miR-4722-3p	HITS-CLIP	28735896
MIRT614834	hsa-miR-4722-3p	HITS-CLIP	28735896
MIRT614834	hsa-miR-4722-3p	HITS-CLIP	28735896
MIRT614836	hsa-miR-5193	HITS-CLIP	28735896
MIRT614836	hsa-miR-5193	HITS-CLIP	28735896
MIRT614836	hsa-miR-5193	HITS-CLIP	28735896
MIRT614836	hsa-miR-5193	HITS-CLIP	28735896
MIRT614836	hsa-miR-5193	HITS-CLIP	28735896
MIRT614836	hsa-miR-5193	HITS-CLIP	28735896
MIRT614836	hsa-miR-5193	HITS-CLIP	28735896
MIRT614837	hsa-miR-5196-3p	HITS-CLIP	28735896
MIRT614837	hsa-miR-5196-3p	HITS-CLIP	28735896
MIRT614837	hsa-miR-5196-3p	HITS-CLIP	28735896
MIRT614837	hsa-miR-5196-3p	HITS-CLIP	28735896
MIRT614837	hsa-miR-5196-3p	HITS-CLIP	28735896
MIRT614837	hsa-miR-5196-3p	HITS-CLIP	28735896
MIRT614837	hsa-miR-5196-3p	HITS-CLIP	28735896
MIRT614835	hsa-miR-660-3p	HITS-CLIP	28735896
MIRT614835	hsa-miR-660-3p	HITS-CLIP	28735896
MIRT614835	hsa-miR-660-3p	HITS-CLIP	28735896
MIRT614835	hsa-miR-660-3p	HITS-CLIP	28735896
MIRT614835	hsa-miR-660-3p	HITS-CLIP	28735896
MIRT614835	hsa-miR-660-3p	HITS-CLIP	28735896
MIRT614835	hsa-miR-660-3p	HITS-CLIP	28735896
MIRT614833	hsa-miR-6727-3p	HITS-CLIP	28735896
MIRT614833	hsa-miR-6727-3p	HITS-CLIP	28735896
MIRT614833	hsa-miR-6727-3p	HITS-CLIP	28735896
MIRT614833	hsa-miR-6727-3p	HITS-CLIP	28735896
MIRT614833	hsa-miR-6727-3p	HITS-CLIP	28735896
MIRT614833	hsa-miR-6727-3p	HITS-CLIP	28735896
MIRT614833	hsa-miR-6727-3p	HITS-CLIP	28735896
MIRT614832	hsa-miR-6747-3p	HITS-CLIP	28735896
MIRT614832	hsa-miR-6747-3p	HITS-CLIP	28735896
MIRT614832	hsa-miR-6747-3p	HITS-CLIP	28735896
MIRT614832	hsa-miR-6747-3p	HITS-CLIP	28735896
MIRT614832	hsa-miR-6747-3p	HITS-CLIP	28735896
MIRT614832	hsa-miR-6747-3p	HITS-CLIP	28735896
MIRT614832	hsa-miR-6747-3p	HITS-CLIP	28735896
MIRT614830	hsa-miR-6828-5p	HITS-CLIP	28735896
MIRT614830	hsa-miR-6828-5p	HITS-CLIP	28735896
MIRT614830	hsa-miR-6828-5p	HITS-CLIP	28735896
MIRT614830	hsa-miR-6828-5p	HITS-CLIP	28735896
MIRT614830	hsa-miR-6828-5p	HITS-CLIP	28735896
MIRT614830	hsa-miR-6828-5p	HITS-CLIP	28735896
MIRT614830	hsa-miR-6828-5p	HITS-CLIP	28735896
MIRT732676	hsa-miR-330-5p	Luciferase reporter assayqRT-PCR	33061606
MIRT736905	hsa-miR-23a-3p	Luciferase reporter assayWestern blottingqRT-PCR	33738140
MIRT614837	hsa-miR-5196-3p	HITS-CLIP	19536157
MIRT614836	hsa-miR-5193	HITS-CLIP	19536157
MIRT614834	hsa-miR-4722-3p	HITS-CLIP	19536157
MIRT614833	hsa-miR-6727-3p	HITS-CLIP	19536157
MIRT614832	hsa-miR-6747-3p	HITS-CLIP	19536157
MIRT614829	hsa-miR-371b-5p	HITS-CLIP	19536157
MIRT614831	hsa-miR-1976	HITS-CLIP	19536157
MIRT614830	hsa-miR-6828-5p	HITS-CLIP	19536157
MIRT700612	hsa-miR-4486	HITS-CLIP	23313552
MIRT700611	hsa-miR-214-5p	HITS-CLIP	23313552
MIRT700610	hsa-miR-6811-3p	HITS-CLIP	23313552
MIRT700609	hsa-miR-6847-3p	HITS-CLIP	23313552
MIRT700608	hsa-miR-4284	HITS-CLIP	23313552
MIRT700607	hsa-miR-24-3p	HITS-CLIP	23313552
MIRT700606	hsa-miR-3652	HITS-CLIP	23313552
MIRT700605	hsa-miR-4430	HITS-CLIP	23313552
MIRT700604	hsa-miR-4505	HITS-CLIP	23313552
MIRT700603	hsa-miR-5787	HITS-CLIP	23313552
MIRT700602	hsa-miR-585-3p	HITS-CLIP	23313552
MIRT700601	hsa-miR-1268a	HITS-CLIP	23313552
MIRT700600	hsa-miR-1268b	HITS-CLIP	23313552
MIRT700599	hsa-miR-7977	HITS-CLIP	23313552
MIRT700598	hsa-miR-6514-3p	HITS-CLIP	23313552
MIRT700597	hsa-miR-647	HITS-CLIP	23313552
MIRT700596	hsa-miR-6842-3p	HITS-CLIP	23313552
MIRT700595	hsa-miR-6821-5p	HITS-CLIP	23313552
MIRT614837	hsa-miR-5196-3p	HITS-CLIP	23824327
MIRT614834	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT614833	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT614832	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT614831	hsa-miR-1976	HITS-CLIP	23824327
MIRT614830	hsa-miR-6828-5p	HITS-CLIP	23824327
MIRT614829	hsa-miR-371b-5p	HITS-CLIP	23824327
MIRT614836	hsa-miR-5193	HITS-CLIP	23824327
MIRT614835	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT614834	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT614833	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT614832	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT614831	hsa-miR-1976	HITS-CLIP	23824327
MIRT614830	hsa-miR-6828-5p	HITS-CLIP	23824327
MIRT614829	hsa-miR-371b-5p	HITS-CLIP	23824327
MIRT614834	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT614833	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT614832	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT614829	hsa-miR-371b-5p	HITS-CLIP	23824327
MIRT614831	hsa-miR-1976	HITS-CLIP	23824327
MIRT614837	hsa-miR-5196-3p	HITS-CLIP	23824327
MIRT614836	hsa-miR-5193	HITS-CLIP	23824327
MIRT614835	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT614834	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT614833	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT614832	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT614831	hsa-miR-1976	HITS-CLIP	23824327
MIRT614830	hsa-miR-6828-5p	HITS-CLIP	23824327
MIRT614829	hsa-miR-371b-5p	HITS-CLIP	23824327
MIRT614836	hsa-miR-5193	HITS-CLIP	23824327
MIRT614835	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT614834	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT614833	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT614832	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT614831	hsa-miR-1976	HITS-CLIP	23824327
MIRT614830	hsa-miR-6828-5p	HITS-CLIP	23824327
MIRT614829	hsa-miR-371b-5p	HITS-CLIP	23824327
MIRT614837	hsa-miR-5196-3p	HITS-CLIP	23824327
MIRT614836	hsa-miR-5193	HITS-CLIP	23824327
MIRT614835	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT614834	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT614833	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT614832	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT614831	hsa-miR-1976	HITS-CLIP	23824327
MIRT614830	hsa-miR-6828-5p	HITS-CLIP	23824327
MIRT614829	hsa-miR-371b-5p	HITS-CLIP	23824327
MIRT1262866	hsa-miR-1	CLIP-seq
MIRT1262867	hsa-miR-1205	CLIP-seq
MIRT1262868	hsa-miR-122	CLIP-seq
MIRT1262869	hsa-miR-1252	CLIP-seq
MIRT1262870	hsa-miR-1304	CLIP-seq
MIRT1262871	hsa-miR-138	CLIP-seq
MIRT1262872	hsa-miR-142-5p	CLIP-seq
MIRT1262873	hsa-miR-149	CLIP-seq
MIRT1262874	hsa-miR-15a	CLIP-seq
MIRT1262875	hsa-miR-15b	CLIP-seq
MIRT1262876	hsa-miR-16	CLIP-seq
MIRT1262877	hsa-miR-1827	CLIP-seq
MIRT1262878	hsa-miR-1909	CLIP-seq
MIRT1262879	hsa-miR-195	CLIP-seq
MIRT1262880	hsa-miR-197	CLIP-seq
MIRT1262881	hsa-miR-2052	CLIP-seq
MIRT1262882	hsa-miR-206	CLIP-seq
MIRT1262883	hsa-miR-2113	CLIP-seq
MIRT1262884	hsa-miR-214	CLIP-seq
MIRT1262885	hsa-miR-219-5p	CLIP-seq
MIRT1262886	hsa-miR-224	CLIP-seq
MIRT1262887	hsa-miR-24	CLIP-seq
MIRT1262888	hsa-miR-300	CLIP-seq
MIRT1262889	hsa-miR-3122	CLIP-seq
MIRT1262890	hsa-miR-3123	CLIP-seq
MIRT1262891	hsa-miR-3126-3p	CLIP-seq
MIRT1262892	hsa-miR-3128	CLIP-seq
MIRT1262893	hsa-miR-3143	CLIP-seq
MIRT1262894	hsa-miR-3150b-3p	CLIP-seq
MIRT1262895	hsa-miR-3153	CLIP-seq
MIRT1262896	hsa-miR-3173-3p	CLIP-seq
MIRT1262897	hsa-miR-3177-3p	CLIP-seq
MIRT1262898	hsa-miR-3185	CLIP-seq
MIRT1262899	hsa-miR-3192	CLIP-seq
MIRT1262900	hsa-miR-331-3p	CLIP-seq
MIRT1262901	hsa-miR-340	CLIP-seq
MIRT1262902	hsa-miR-34a	CLIP-seq
MIRT1262903	hsa-miR-34c-5p	CLIP-seq
MIRT1262904	hsa-miR-3612	CLIP-seq
MIRT1262905	hsa-miR-3613-3p	CLIP-seq
MIRT1262906	hsa-miR-361-3p	CLIP-seq
MIRT1262907	hsa-miR-3619-5p	CLIP-seq
MIRT1262908	hsa-miR-3655	CLIP-seq
MIRT1262909	hsa-miR-3689a-3p	CLIP-seq
MIRT1262910	hsa-miR-3689c	CLIP-seq
MIRT1262911	hsa-miR-3689d	CLIP-seq
MIRT1262912	hsa-miR-371-5p	CLIP-seq
MIRT1262913	hsa-miR-381	CLIP-seq
MIRT1262914	hsa-miR-3913-5p	CLIP-seq
MIRT1262915	hsa-miR-3919	CLIP-seq
MIRT1262916	hsa-miR-3921	CLIP-seq
MIRT1262917	hsa-miR-3925-5p	CLIP-seq
MIRT1262918	hsa-miR-3926	CLIP-seq
MIRT1262919	hsa-miR-3929	CLIP-seq
MIRT739870	hsa-miR-3974	CLIP-seq
MIRT1262920	hsa-miR-409-3p	CLIP-seq
MIRT1262921	hsa-miR-412	CLIP-seq
MIRT1262922	hsa-miR-424	CLIP-seq
MIRT1262923	hsa-miR-4261	CLIP-seq
MIRT1262924	hsa-miR-4265	CLIP-seq
MIRT1262925	hsa-miR-4269	CLIP-seq
MIRT1262926	hsa-miR-4296	CLIP-seq
MIRT1262927	hsa-miR-4302	CLIP-seq
MIRT1262928	hsa-miR-4322	CLIP-seq
MIRT1262929	hsa-miR-4419a	CLIP-seq
MIRT1262930	hsa-miR-4419b	CLIP-seq
MIRT1262931	hsa-miR-4427	CLIP-seq
MIRT1262932	hsa-miR-4455	CLIP-seq
MIRT1262933	hsa-miR-4478	CLIP-seq
MIRT1262934	hsa-miR-4496	CLIP-seq
MIRT1262935	hsa-miR-449a	CLIP-seq
MIRT1262936	hsa-miR-449b	CLIP-seq
MIRT1262937	hsa-miR-4510	CLIP-seq
MIRT1262938	hsa-miR-4514	CLIP-seq
MIRT1262939	hsa-miR-4524	CLIP-seq
MIRT1262940	hsa-miR-4530	CLIP-seq
MIRT1262941	hsa-miR-4537	CLIP-seq
MIRT1262942	hsa-miR-4649-3p	CLIP-seq
MIRT1262943	hsa-miR-4653-5p	CLIP-seq
MIRT1262944	hsa-miR-4668-5p	CLIP-seq
MIRT1262945	hsa-miR-4680-3p	CLIP-seq
MIRT739869	hsa-miR-4690-3p	CLIP-seq
MIRT1262946	hsa-miR-4692	CLIP-seq
MIRT1262947	hsa-miR-4694-3p	CLIP-seq
MIRT1262948	hsa-miR-4698	CLIP-seq
MIRT1262949	hsa-miR-4720-5p	CLIP-seq
MIRT1262950	hsa-miR-4722-5p	CLIP-seq
MIRT739868	hsa-miR-4726-3p	CLIP-seq
MIRT1262951	hsa-miR-4728-5p	CLIP-seq
MIRT1262952	hsa-miR-4738-3p	CLIP-seq
MIRT1262953	hsa-miR-4753-3p	CLIP-seq
MIRT1262954	hsa-miR-4761-5p	CLIP-seq
MIRT1262955	hsa-miR-4763-5p	CLIP-seq
MIRT1262956	hsa-miR-4768-3p	CLIP-seq
MIRT1262957	hsa-miR-4768-5p	CLIP-seq
MIRT1262958	hsa-miR-4779	CLIP-seq
MIRT1262959	hsa-miR-4782-3p	CLIP-seq
MIRT1262960	hsa-miR-4784	CLIP-seq
MIRT1262961	hsa-miR-4793-5p	CLIP-seq
MIRT1262962	hsa-miR-4798-5p	CLIP-seq
MIRT1262963	hsa-miR-4799-3p	CLIP-seq
MIRT1262964	hsa-miR-483-3p	CLIP-seq
MIRT1262965	hsa-miR-485-5p	CLIP-seq
MIRT1262966	hsa-miR-490-3p	CLIP-seq
MIRT1262967	hsa-miR-495	CLIP-seq
MIRT1262968	hsa-miR-497	CLIP-seq
MIRT1262969	hsa-miR-503	CLIP-seq
MIRT1262970	hsa-miR-522	CLIP-seq
MIRT1262971	hsa-miR-543	CLIP-seq
MIRT1262972	hsa-miR-548q	CLIP-seq
MIRT1262973	hsa-miR-548s	CLIP-seq
MIRT1262974	hsa-miR-550a	CLIP-seq
MIRT1262975	hsa-miR-564	CLIP-seq
MIRT1262976	hsa-miR-609	CLIP-seq
MIRT1262977	hsa-miR-613	CLIP-seq
MIRT1262978	hsa-miR-646	CLIP-seq
MIRT1262979	hsa-miR-650	CLIP-seq
MIRT1262980	hsa-miR-665	CLIP-seq
MIRT1262981	hsa-miR-668	CLIP-seq
MIRT1262982	hsa-miR-758	CLIP-seq
MIRT1262983	hsa-miR-761	CLIP-seq
MIRT739867	hsa-miR-764	CLIP-seq
MIRT1262984	hsa-miR-765	CLIP-seq
MIRT1262985	hsa-miR-922	CLIP-seq
MIRT1262986	hsa-miR-940	CLIP-seq
MIRT1262877	hsa-miR-1827	CLIP-seq
MIRT1262899	hsa-miR-3192	CLIP-seq
MIRT1262909	hsa-miR-3689a-3p	CLIP-seq
MIRT1262910	hsa-miR-3689c	CLIP-seq
MIRT1262911	hsa-miR-3689d	CLIP-seq
MIRT1262950	hsa-miR-4722-5p	CLIP-seq
MIRT1262951	hsa-miR-4728-5p	CLIP-seq
MIRT1262956	hsa-miR-4768-3p	CLIP-seq
MIRT1262966	hsa-miR-490-3p	CLIP-seq
MIRT1262986	hsa-miR-940	CLIP-seq
MIRT1262909	hsa-miR-3689a-3p	CLIP-seq
MIRT1262910	hsa-miR-3689c	CLIP-seq
MIRT1262951	hsa-miR-4728-5p	CLIP-seq
MIRT2077396	hsa-miR-1267	CLIP-seq
MIRT2077397	hsa-miR-1268	CLIP-seq
MIRT2077398	hsa-miR-1273g	CLIP-seq
MIRT2077399	hsa-miR-1285	CLIP-seq
MIRT1262877	hsa-miR-1827	CLIP-seq
MIRT2077400	hsa-miR-1915	CLIP-seq
MIRT2077401	hsa-miR-205	CLIP-seq
MIRT2077402	hsa-miR-2114	CLIP-seq
MIRT1262887	hsa-miR-24	CLIP-seq
MIRT2077403	hsa-miR-3117-5p	CLIP-seq
MIRT2077404	hsa-miR-3120-5p	CLIP-seq
MIRT1262889	hsa-miR-3122	CLIP-seq
MIRT2077405	hsa-miR-3187-5p	CLIP-seq
MIRT1262899	hsa-miR-3192	CLIP-seq
MIRT1262904	hsa-miR-3612	CLIP-seq
MIRT1262906	hsa-miR-361-3p	CLIP-seq
MIRT2077406	hsa-miR-3618	CLIP-seq
MIRT1262909	hsa-miR-3689a-3p	CLIP-seq
MIRT1262910	hsa-miR-3689c	CLIP-seq
MIRT1262911	hsa-miR-3689d	CLIP-seq
MIRT1262914	hsa-miR-3913-5p	CLIP-seq
MIRT1262919	hsa-miR-3929	CLIP-seq
MIRT1262920	hsa-miR-409-3p	CLIP-seq
MIRT1262925	hsa-miR-4269	CLIP-seq
MIRT2077407	hsa-miR-4308	CLIP-seq
MIRT2077408	hsa-miR-432	CLIP-seq
MIRT1262930	hsa-miR-4419b	CLIP-seq
MIRT2077409	hsa-miR-4423-3p	CLIP-seq
MIRT1262932	hsa-miR-4455	CLIP-seq
MIRT2077410	hsa-miR-4477a	CLIP-seq
MIRT1262933	hsa-miR-4478	CLIP-seq
MIRT1262938	hsa-miR-4514	CLIP-seq
MIRT1262941	hsa-miR-4537	CLIP-seq
MIRT1262942	hsa-miR-4649-3p	CLIP-seq
MIRT2077411	hsa-miR-4667-5p	CLIP-seq
MIRT2077412	hsa-miR-4668-3p	CLIP-seq
MIRT2077413	hsa-miR-4677-3p	CLIP-seq
MIRT2077414	hsa-miR-4677-5p	CLIP-seq
MIRT2077415	hsa-miR-4679	CLIP-seq
MIRT2077416	hsa-miR-4684-5p	CLIP-seq
MIRT1262946	hsa-miR-4692	CLIP-seq
MIRT2077417	hsa-miR-4700-5p	CLIP-seq
MIRT1262950	hsa-miR-4722-5p	CLIP-seq
MIRT1262951	hsa-miR-4728-5p	CLIP-seq
MIRT2077418	hsa-miR-4731-5p	CLIP-seq
MIRT2077419	hsa-miR-4742-5p	CLIP-seq
MIRT2077420	hsa-miR-4762-3p	CLIP-seq
MIRT2077421	hsa-miR-4766-5p	CLIP-seq
MIRT1262956	hsa-miR-4768-3p	CLIP-seq
MIRT2077422	hsa-miR-4777-5p	CLIP-seq
MIRT1262961	hsa-miR-4793-5p	CLIP-seq
MIRT1262965	hsa-miR-485-5p	CLIP-seq
MIRT1262966	hsa-miR-490-3p	CLIP-seq
MIRT2077423	hsa-miR-494	CLIP-seq
MIRT2077424	hsa-miR-500a	CLIP-seq
MIRT2077425	hsa-miR-508-3p	CLIP-seq
MIRT2077426	hsa-miR-518d-5p	CLIP-seq
MIRT2077427	hsa-miR-519b-5p	CLIP-seq
MIRT2077428	hsa-miR-519c-5p	CLIP-seq
MIRT2077429	hsa-miR-520c-5p	CLIP-seq
MIRT2077430	hsa-miR-526a	CLIP-seq
MIRT2077431	hsa-miR-532-3p	CLIP-seq
MIRT2077432	hsa-miR-548n	CLIP-seq
MIRT2077433	hsa-miR-563	CLIP-seq
MIRT1262975	hsa-miR-564	CLIP-seq
MIRT2077434	hsa-miR-585	CLIP-seq
MIRT1262976	hsa-miR-609	CLIP-seq
MIRT2077435	hsa-miR-612	CLIP-seq
MIRT2077436	hsa-miR-637	CLIP-seq
MIRT1262979	hsa-miR-650	CLIP-seq
MIRT1262980	hsa-miR-665	CLIP-seq
MIRT2077437	hsa-miR-890	CLIP-seq
MIRT2077438	hsa-miR-934	CLIP-seq
MIRT1262986	hsa-miR-940	CLIP-seq
MIRT2303931	hsa-miR-1184	CLIP-seq
MIRT2303932	hsa-miR-1207-3p	CLIP-seq
MIRT2303933	hsa-miR-1229	CLIP-seq
MIRT2303934	hsa-miR-1253	CLIP-seq
MIRT2303935	hsa-miR-1266	CLIP-seq
MIRT2077397	hsa-miR-1268	CLIP-seq
MIRT2077399	hsa-miR-1285	CLIP-seq
MIRT2303936	hsa-miR-1292	CLIP-seq
MIRT2303937	hsa-miR-1321	CLIP-seq
MIRT2303938	hsa-miR-1343	CLIP-seq
MIRT2303939	hsa-miR-154	CLIP-seq
MIRT1262874	hsa-miR-15a	CLIP-seq
MIRT1262875	hsa-miR-15b	CLIP-seq
MIRT1262876	hsa-miR-16	CLIP-seq
MIRT1262877	hsa-miR-1827	CLIP-seq
MIRT1262878	hsa-miR-1909	CLIP-seq
MIRT2077400	hsa-miR-1915	CLIP-seq
MIRT1262879	hsa-miR-195	CLIP-seq
MIRT2077401	hsa-miR-205	CLIP-seq
MIRT2077402	hsa-miR-2114	CLIP-seq
MIRT1262887	hsa-miR-24	CLIP-seq
MIRT2303940	hsa-miR-2861	CLIP-seq
MIRT2303941	hsa-miR-296-3p	CLIP-seq
MIRT1262895	hsa-miR-3153	CLIP-seq
MIRT2303942	hsa-miR-3159	CLIP-seq
MIRT2303943	hsa-miR-3175	CLIP-seq
MIRT2077405	hsa-miR-3187-5p	CLIP-seq
MIRT1262899	hsa-miR-3192	CLIP-seq
MIRT2303944	hsa-miR-3614-5p	CLIP-seq
MIRT2303945	hsa-miR-3650	CLIP-seq
MIRT2303946	hsa-miR-3663-3p	CLIP-seq
MIRT1262909	hsa-miR-3689a-3p	CLIP-seq
MIRT1262910	hsa-miR-3689c	CLIP-seq
MIRT1262911	hsa-miR-3689d	CLIP-seq
MIRT1262919	hsa-miR-3929	CLIP-seq
MIRT2303947	hsa-miR-3944-5p	CLIP-seq
MIRT1262920	hsa-miR-409-3p	CLIP-seq
MIRT1262922	hsa-miR-424	CLIP-seq
MIRT1262923	hsa-miR-4261	CLIP-seq
MIRT2303948	hsa-miR-4270	CLIP-seq
MIRT2303949	hsa-miR-4282	CLIP-seq
MIRT2303950	hsa-miR-4292	CLIP-seq
MIRT1262930	hsa-miR-4419b	CLIP-seq
MIRT2303951	hsa-miR-4441	CLIP-seq
MIRT2303952	hsa-miR-4471	CLIP-seq
MIRT2077410	hsa-miR-4477a	CLIP-seq
MIRT2303953	hsa-miR-4477b	CLIP-seq
MIRT1262933	hsa-miR-4478	CLIP-seq
MIRT1262938	hsa-miR-4514	CLIP-seq
MIRT2303954	hsa-miR-4518	CLIP-seq
MIRT1262939	hsa-miR-4524	CLIP-seq
MIRT1262941	hsa-miR-4537	CLIP-seq
MIRT2303955	hsa-miR-4641	CLIP-seq
MIRT1262942	hsa-miR-4649-3p	CLIP-seq
MIRT2077411	hsa-miR-4667-5p	CLIP-seq
MIRT739869	hsa-miR-4690-3p	CLIP-seq
MIRT1262946	hsa-miR-4692	CLIP-seq
MIRT1262948	hsa-miR-4698	CLIP-seq
MIRT2077417	hsa-miR-4700-5p	CLIP-seq
MIRT2303956	hsa-miR-4716-5p	CLIP-seq
MIRT1262950	hsa-miR-4722-5p	CLIP-seq
MIRT739868	hsa-miR-4726-3p	CLIP-seq
MIRT1262951	hsa-miR-4728-5p	CLIP-seq
MIRT2077418	hsa-miR-4731-5p	CLIP-seq
MIRT2303957	hsa-miR-4739	CLIP-seq
MIRT2303958	hsa-miR-4756-5p	CLIP-seq
MIRT2303959	hsa-miR-4757-5p	CLIP-seq
MIRT1262956	hsa-miR-4768-3p	CLIP-seq
MIRT1262961	hsa-miR-4793-5p	CLIP-seq
MIRT1262965	hsa-miR-485-5p	CLIP-seq
MIRT1262966	hsa-miR-490-3p	CLIP-seq
MIRT1262968	hsa-miR-497	CLIP-seq
MIRT1262969	hsa-miR-503	CLIP-seq
MIRT2077425	hsa-miR-508-3p	CLIP-seq
MIRT2303960	hsa-miR-508-5p	CLIP-seq
MIRT2303961	hsa-miR-516a-3p	CLIP-seq
MIRT1262970	hsa-miR-522	CLIP-seq
MIRT2303962	hsa-miR-526b	CLIP-seq
MIRT1262975	hsa-miR-564	CLIP-seq
MIRT2303963	hsa-miR-580	CLIP-seq
MIRT2077434	hsa-miR-585	CLIP-seq
MIRT1262976	hsa-miR-609	CLIP-seq
MIRT2077435	hsa-miR-612	CLIP-seq
MIRT2303964	hsa-miR-624	CLIP-seq
MIRT2077436	hsa-miR-637	CLIP-seq
MIRT1262978	hsa-miR-646	CLIP-seq
MIRT2303965	hsa-miR-661	CLIP-seq
MIRT2303966	hsa-miR-766	CLIP-seq
MIRT2077437	hsa-miR-890	CLIP-seq
MIRT1262986	hsa-miR-940	CLIP-seq
MIRT2393008	hsa-miR-1183	CLIP-seq
MIRT2393009	hsa-miR-1257	CLIP-seq
MIRT2077398	hsa-miR-1273g	CLIP-seq
MIRT1262877	hsa-miR-1827	CLIP-seq
MIRT2077400	hsa-miR-1915	CLIP-seq
MIRT2077401	hsa-miR-205	CLIP-seq
MIRT2077402	hsa-miR-2114	CLIP-seq
MIRT2393010	hsa-miR-2467-3p	CLIP-seq
MIRT2393011	hsa-miR-3065-3p	CLIP-seq
MIRT2077403	hsa-miR-3117-5p	CLIP-seq
MIRT2077404	hsa-miR-3120-5p	CLIP-seq
MIRT2393012	hsa-miR-3146	CLIP-seq
MIRT1262899	hsa-miR-3192	CLIP-seq
MIRT2393013	hsa-miR-326	CLIP-seq
MIRT2077406	hsa-miR-3618	CLIP-seq
MIRT2393014	hsa-miR-3678-3p	CLIP-seq
MIRT2393015	hsa-miR-3685	CLIP-seq
MIRT1262909	hsa-miR-3689a-3p	CLIP-seq
MIRT1262910	hsa-miR-3689c	CLIP-seq
MIRT1262911	hsa-miR-3689d	CLIP-seq
MIRT2393016	hsa-miR-384	CLIP-seq
MIRT1262919	hsa-miR-3929	CLIP-seq
MIRT2393017	hsa-miR-4254	CLIP-seq
MIRT2393018	hsa-miR-4329	CLIP-seq
MIRT1262930	hsa-miR-4419b	CLIP-seq
MIRT2393019	hsa-miR-4451	CLIP-seq
MIRT1262933	hsa-miR-4478	CLIP-seq
MIRT2393020	hsa-miR-452	CLIP-seq
MIRT1262942	hsa-miR-4649-3p	CLIP-seq
MIRT2393021	hsa-miR-4676-3p	CLIP-seq
MIRT2393022	hsa-miR-4693-5p	CLIP-seq
MIRT1262950	hsa-miR-4722-5p	CLIP-seq
MIRT739868	hsa-miR-4726-3p	CLIP-seq
MIRT1262951	hsa-miR-4728-5p	CLIP-seq
MIRT2077420	hsa-miR-4762-3p	CLIP-seq
MIRT2077421	hsa-miR-4766-5p	CLIP-seq
MIRT1262956	hsa-miR-4768-3p	CLIP-seq
MIRT2393023	hsa-miR-485-3p	CLIP-seq
MIRT1262965	hsa-miR-485-5p	CLIP-seq
MIRT2393024	hsa-miR-487b	CLIP-seq
MIRT1262966	hsa-miR-490-3p	CLIP-seq
MIRT2077424	hsa-miR-500a	CLIP-seq
MIRT1262970	hsa-miR-522	CLIP-seq
MIRT2077433	hsa-miR-563	CLIP-seq
MIRT1262975	hsa-miR-564	CLIP-seq
MIRT2077437	hsa-miR-890	CLIP-seq
MIRT2077438	hsa-miR-934	CLIP-seq
MIRT1262986	hsa-miR-940	CLIP-seq
MIRT2077421	hsa-miR-4766-5p	CLIP-seq
MIRT1262877	hsa-miR-1827	CLIP-seq
MIRT1262889	hsa-miR-3122	CLIP-seq
MIRT2457160	hsa-miR-3164	CLIP-seq
MIRT1262899	hsa-miR-3192	CLIP-seq
MIRT2457161	hsa-miR-3675-3p	CLIP-seq
MIRT1262909	hsa-miR-3689a-3p	CLIP-seq
MIRT1262910	hsa-miR-3689c	CLIP-seq
MIRT1262911	hsa-miR-3689d	CLIP-seq
MIRT1262912	hsa-miR-371-5p	CLIP-seq
MIRT1262914	hsa-miR-3913-5p	CLIP-seq
MIRT1262938	hsa-miR-4514	CLIP-seq
MIRT1262941	hsa-miR-4537	CLIP-seq
MIRT2077416	hsa-miR-4684-5p	CLIP-seq
MIRT1262946	hsa-miR-4692	CLIP-seq
MIRT1262948	hsa-miR-4698	CLIP-seq
MIRT1262950	hsa-miR-4722-5p	CLIP-seq
MIRT1262951	hsa-miR-4728-5p	CLIP-seq
MIRT1262952	hsa-miR-4738-3p	CLIP-seq
MIRT1262956	hsa-miR-4768-3p	CLIP-seq
MIRT1262966	hsa-miR-490-3p	CLIP-seq
MIRT1262986	hsa-miR-940	CLIP-seq
MIRT2600816	hsa-miR-1228	CLIP-seq
MIRT2600817	hsa-miR-1231	CLIP-seq
MIRT2600818	hsa-miR-1236	CLIP-seq
MIRT2600819	hsa-miR-1245b-3p	CLIP-seq
MIRT1262869	hsa-miR-1252	CLIP-seq
MIRT2600820	hsa-miR-1256	CLIP-seq
MIRT2077396	hsa-miR-1267	CLIP-seq
MIRT2077398	hsa-miR-1273g	CLIP-seq
MIRT2600821	hsa-miR-1282	CLIP-seq
MIRT2077399	hsa-miR-1285	CLIP-seq
MIRT2303938	hsa-miR-1343	CLIP-seq
MIRT1262872	hsa-miR-142-5p	CLIP-seq
MIRT2600822	hsa-miR-147	CLIP-seq
MIRT1262873	hsa-miR-149	CLIP-seq
MIRT1262874	hsa-miR-15a	CLIP-seq
MIRT1262875	hsa-miR-15b	CLIP-seq
MIRT1262876	hsa-miR-16	CLIP-seq
MIRT1262877	hsa-miR-1827	CLIP-seq
MIRT2600823	hsa-miR-186	CLIP-seq
MIRT1262878	hsa-miR-1909	CLIP-seq
MIRT2077400	hsa-miR-1915	CLIP-seq
MIRT2600824	hsa-miR-192	CLIP-seq
MIRT1262879	hsa-miR-195	CLIP-seq
MIRT2600825	hsa-miR-199a-3p	CLIP-seq
MIRT2600826	hsa-miR-199b-3p	CLIP-seq
MIRT2077401	hsa-miR-205	CLIP-seq
MIRT1262881	hsa-miR-2052	CLIP-seq
MIRT2600827	hsa-miR-210	CLIP-seq
MIRT1262883	hsa-miR-2113	CLIP-seq
MIRT2077402	hsa-miR-2114	CLIP-seq
MIRT1262884	hsa-miR-214	CLIP-seq
MIRT2600828	hsa-miR-215	CLIP-seq
MIRT2600829	hsa-miR-219-1-3p	CLIP-seq
MIRT1262885	hsa-miR-219-5p	CLIP-seq
MIRT2600830	hsa-miR-223	CLIP-seq
MIRT1262887	hsa-miR-24	CLIP-seq
MIRT2600831	hsa-miR-296-5p	CLIP-seq
MIRT2600832	hsa-miR-3074-5p	CLIP-seq
MIRT2077403	hsa-miR-3117-5p	CLIP-seq
MIRT2600833	hsa-miR-3119	CLIP-seq
MIRT2077404	hsa-miR-3120-5p	CLIP-seq
MIRT1262889	hsa-miR-3122	CLIP-seq
MIRT2600834	hsa-miR-3129-5p	CLIP-seq
MIRT2600835	hsa-miR-3133	CLIP-seq
MIRT1262893	hsa-miR-3143	CLIP-seq
MIRT2600836	hsa-miR-3144-5p	CLIP-seq
MIRT2600837	hsa-miR-3148	CLIP-seq
MIRT2077405	hsa-miR-3187-5p	CLIP-seq
MIRT2600838	hsa-miR-3188	CLIP-seq
MIRT2600839	hsa-miR-3191	CLIP-seq
MIRT1262899	hsa-miR-3192	CLIP-seq
MIRT1262900	hsa-miR-331-3p	CLIP-seq
MIRT1262901	hsa-miR-340	CLIP-seq
MIRT1262904	hsa-miR-3612	CLIP-seq
MIRT2077406	hsa-miR-3618	CLIP-seq
MIRT1262907	hsa-miR-3619-5p	CLIP-seq
MIRT2600840	hsa-miR-3621	CLIP-seq
MIRT2600841	hsa-miR-3622a-3p	CLIP-seq
MIRT2600842	hsa-miR-3622a-5p	CLIP-seq
MIRT2600843	hsa-miR-3622b-3p	CLIP-seq
MIRT2303945	hsa-miR-3650	CLIP-seq
MIRT1262908	hsa-miR-3655	CLIP-seq
MIRT2600844	hsa-miR-3661	CLIP-seq
MIRT2600845	hsa-miR-3673	CLIP-seq
MIRT2457161	hsa-miR-3675-3p	CLIP-seq
MIRT1262909	hsa-miR-3689a-3p	CLIP-seq
MIRT1262910	hsa-miR-3689c	CLIP-seq
MIRT1262911	hsa-miR-3689d	CLIP-seq
MIRT2600846	hsa-miR-3690	CLIP-seq
MIRT1262912	hsa-miR-371-5p	CLIP-seq
MIRT2600847	hsa-miR-378g	CLIP-seq
MIRT2600848	hsa-miR-3911	CLIP-seq
MIRT1262914	hsa-miR-3913-5p	CLIP-seq
MIRT1262916	hsa-miR-3921	CLIP-seq
MIRT1262918	hsa-miR-3926	CLIP-seq
MIRT1262919	hsa-miR-3929	CLIP-seq
MIRT2600849	hsa-miR-3937	CLIP-seq
MIRT2600850	hsa-miR-3938	CLIP-seq
MIRT2600851	hsa-miR-3941	CLIP-seq
MIRT2600852	hsa-miR-410	CLIP-seq
MIRT1262921	hsa-miR-412	CLIP-seq
MIRT1262922	hsa-miR-424	CLIP-seq
MIRT2393017	hsa-miR-4254	CLIP-seq
MIRT1262923	hsa-miR-4261	CLIP-seq
MIRT1262925	hsa-miR-4269	CLIP-seq
MIRT2600853	hsa-miR-4273	CLIP-seq
MIRT2600854	hsa-miR-4279	CLIP-seq
MIRT2303949	hsa-miR-4282	CLIP-seq
MIRT2600855	hsa-miR-4288	CLIP-seq
MIRT2303950	hsa-miR-4292	CLIP-seq
MIRT2600856	hsa-miR-4299	CLIP-seq
MIRT1262927	hsa-miR-4302	CLIP-seq
MIRT2600857	hsa-miR-4303	CLIP-seq
MIRT2077407	hsa-miR-4308	CLIP-seq
MIRT2600858	hsa-miR-433	CLIP-seq
MIRT1262930	hsa-miR-4419b	CLIP-seq
MIRT2077409	hsa-miR-4423-3p	CLIP-seq
MIRT1262931	hsa-miR-4427	CLIP-seq
MIRT2600859	hsa-miR-4449	CLIP-seq
MIRT2600860	hsa-miR-4456	CLIP-seq
MIRT1262933	hsa-miR-4478	CLIP-seq
MIRT1262934	hsa-miR-4496	CLIP-seq
MIRT1262938	hsa-miR-4514	CLIP-seq
MIRT2393020	hsa-miR-452	CLIP-seq
MIRT1262939	hsa-miR-4524	CLIP-seq
MIRT1262940	hsa-miR-4530	CLIP-seq
MIRT1262941	hsa-miR-4537	CLIP-seq
MIRT2600861	hsa-miR-4643	CLIP-seq
MIRT1262942	hsa-miR-4649-3p	CLIP-seq
MIRT2600862	hsa-miR-4652-5p	CLIP-seq
MIRT1262943	hsa-miR-4653-5p	CLIP-seq
MIRT2600863	hsa-miR-466	CLIP-seq
MIRT2077411	hsa-miR-4667-5p	CLIP-seq
MIRT2077412	hsa-miR-4668-3p	CLIP-seq
MIRT2600864	hsa-miR-4671-5p	CLIP-seq
MIRT2600865	hsa-miR-4672	CLIP-seq
MIRT2393021	hsa-miR-4676-3p	CLIP-seq
MIRT2077414	hsa-miR-4677-5p	CLIP-seq
MIRT1262945	hsa-miR-4680-3p	CLIP-seq
MIRT2600866	hsa-miR-4682	CLIP-seq
MIRT2600867	hsa-miR-4683	CLIP-seq
MIRT2077416	hsa-miR-4684-5p	CLIP-seq
MIRT2600868	hsa-miR-4685-5p	CLIP-seq
MIRT1262946	hsa-miR-4692	CLIP-seq
MIRT1262947	hsa-miR-4694-3p	CLIP-seq
MIRT2600869	hsa-miR-4694-5p	CLIP-seq
MIRT2600870	hsa-miR-4697-3p	CLIP-seq
MIRT1262948	hsa-miR-4698	CLIP-seq
MIRT2077417	hsa-miR-4700-5p	CLIP-seq
MIRT2600871	hsa-miR-4701-5p	CLIP-seq
MIRT2600872	hsa-miR-4714-3p	CLIP-seq
MIRT2303956	hsa-miR-4716-5p	CLIP-seq
MIRT1262950	hsa-miR-4722-5p	CLIP-seq
MIRT739868	hsa-miR-4726-3p	CLIP-seq
MIRT1262951	hsa-miR-4728-5p	CLIP-seq
MIRT1262952	hsa-miR-4738-3p	CLIP-seq
MIRT2303959	hsa-miR-4757-5p	CLIP-seq
MIRT2600873	hsa-miR-4761-3p	CLIP-seq
MIRT1262954	hsa-miR-4761-5p	CLIP-seq
MIRT2077420	hsa-miR-4762-3p	CLIP-seq
MIRT2077421	hsa-miR-4766-5p	CLIP-seq
MIRT1262956	hsa-miR-4768-3p	CLIP-seq
MIRT2077422	hsa-miR-4777-5p	CLIP-seq
MIRT1262959	hsa-miR-4782-3p	CLIP-seq
MIRT2600874	hsa-miR-4783-3p	CLIP-seq
MIRT2600875	hsa-miR-4789-3p	CLIP-seq
MIRT2600876	hsa-miR-4789-5p	CLIP-seq
MIRT2600877	hsa-miR-4790-3p	CLIP-seq
MIRT1262961	hsa-miR-4793-5p	CLIP-seq
MIRT2600878	hsa-miR-4799-5p	CLIP-seq
MIRT2600879	hsa-miR-4800-3p	CLIP-seq
MIRT1262964	hsa-miR-483-3p	CLIP-seq
MIRT2393023	hsa-miR-485-3p	CLIP-seq
MIRT1262965	hsa-miR-485-5p	CLIP-seq
MIRT1262966	hsa-miR-490-3p	CLIP-seq
MIRT2077423	hsa-miR-494	CLIP-seq
MIRT1262968	hsa-miR-497	CLIP-seq
MIRT2077424	hsa-miR-500a	CLIP-seq
MIRT1262969	hsa-miR-503	CLIP-seq
MIRT2077425	hsa-miR-508-3p	CLIP-seq
MIRT2600880	hsa-miR-5095	CLIP-seq
MIRT2600881	hsa-miR-513a-3p	CLIP-seq
MIRT2077426	hsa-miR-518d-5p	CLIP-seq
MIRT2077427	hsa-miR-519b-5p	CLIP-seq
MIRT2077428	hsa-miR-519c-5p	CLIP-seq
MIRT2077429	hsa-miR-520c-5p	CLIP-seq
MIRT1262970	hsa-miR-522	CLIP-seq
MIRT2077430	hsa-miR-526a	CLIP-seq
MIRT1262971	hsa-miR-543	CLIP-seq
MIRT2600882	hsa-miR-548ac	CLIP-seq
MIRT2600883	hsa-miR-548ae	CLIP-seq
MIRT2600884	hsa-miR-548aj	CLIP-seq
MIRT2600885	hsa-miR-548am	CLIP-seq
MIRT2600886	hsa-miR-548c-3p	CLIP-seq
MIRT2600887	hsa-miR-548d-3p	CLIP-seq
MIRT1262972	hsa-miR-548q	CLIP-seq
MIRT1262973	hsa-miR-548s	CLIP-seq
MIRT2600888	hsa-miR-548x	CLIP-seq
MIRT2600889	hsa-miR-548z	CLIP-seq
MIRT2077433	hsa-miR-563	CLIP-seq
MIRT1262975	hsa-miR-564	CLIP-seq
MIRT2600890	hsa-miR-571	CLIP-seq
MIRT2600891	hsa-miR-588	CLIP-seq
MIRT2600892	hsa-miR-600	CLIP-seq
MIRT2077435	hsa-miR-612	CLIP-seq
MIRT2600893	hsa-miR-618	CLIP-seq
MIRT2600894	hsa-miR-626	CLIP-seq
MIRT2600895	hsa-miR-631	CLIP-seq
MIRT2600896	hsa-miR-632	CLIP-seq
MIRT2600897	hsa-miR-635	CLIP-seq
MIRT2600898	hsa-miR-644	CLIP-seq
MIRT1262978	hsa-miR-646	CLIP-seq
MIRT1262979	hsa-miR-650	CLIP-seq
MIRT2600899	hsa-miR-663b	CLIP-seq
MIRT2600900	hsa-miR-670	CLIP-seq
MIRT1262982	hsa-miR-758	CLIP-seq
MIRT1262983	hsa-miR-761	CLIP-seq
MIRT2600901	hsa-miR-769-5p	CLIP-seq
MIRT2077437	hsa-miR-890	CLIP-seq
MIRT1262985	hsa-miR-922	CLIP-seq
MIRT2077438	hsa-miR-934	CLIP-seq
MIRT2600902	hsa-miR-936	CLIP-seq
MIRT1262986	hsa-miR-940	CLIP-seq
MIRT2600816	hsa-miR-1228	CLIP-seq
MIRT2600817	hsa-miR-1231	CLIP-seq
MIRT2600818	hsa-miR-1236	CLIP-seq
MIRT2600819	hsa-miR-1245b-3p	CLIP-seq
MIRT1262869	hsa-miR-1252	CLIP-seq
MIRT2600820	hsa-miR-1256	CLIP-seq
MIRT2077396	hsa-miR-1267	CLIP-seq
MIRT2077398	hsa-miR-1273g	CLIP-seq
MIRT2600821	hsa-miR-1282	CLIP-seq
MIRT2077399	hsa-miR-1285	CLIP-seq
MIRT2303938	hsa-miR-1343	CLIP-seq
MIRT1262872	hsa-miR-142-5p	CLIP-seq
MIRT2600822	hsa-miR-147	CLIP-seq
MIRT1262873	hsa-miR-149	CLIP-seq
MIRT1262874	hsa-miR-15a	CLIP-seq
MIRT1262875	hsa-miR-15b	CLIP-seq
MIRT1262876	hsa-miR-16	CLIP-seq
MIRT1262877	hsa-miR-1827	CLIP-seq
MIRT2600823	hsa-miR-186	CLIP-seq
MIRT1262878	hsa-miR-1909	CLIP-seq
MIRT2077400	hsa-miR-1915	CLIP-seq
MIRT2600824	hsa-miR-192	CLIP-seq
MIRT1262879	hsa-miR-195	CLIP-seq
MIRT2600825	hsa-miR-199a-3p	CLIP-seq
MIRT2600826	hsa-miR-199b-3p	CLIP-seq
MIRT2077401	hsa-miR-205	CLIP-seq
MIRT1262881	hsa-miR-2052	CLIP-seq
MIRT2600827	hsa-miR-210	CLIP-seq
MIRT1262883	hsa-miR-2113	CLIP-seq
MIRT2077402	hsa-miR-2114	CLIP-seq
MIRT1262884	hsa-miR-214	CLIP-seq
MIRT2600828	hsa-miR-215	CLIP-seq
MIRT2600829	hsa-miR-219-1-3p	CLIP-seq
MIRT1262885	hsa-miR-219-5p	CLIP-seq
MIRT2600830	hsa-miR-223	CLIP-seq
MIRT1262887	hsa-miR-24	CLIP-seq
MIRT2600831	hsa-miR-296-5p	CLIP-seq
MIRT1262888	hsa-miR-300	CLIP-seq
MIRT2600832	hsa-miR-3074-5p	CLIP-seq
MIRT2077403	hsa-miR-3117-5p	CLIP-seq
MIRT2600833	hsa-miR-3119	CLIP-seq
MIRT2077404	hsa-miR-3120-5p	CLIP-seq
MIRT1262889	hsa-miR-3122	CLIP-seq
MIRT2600834	hsa-miR-3129-5p	CLIP-seq
MIRT2600835	hsa-miR-3133	CLIP-seq
MIRT1262893	hsa-miR-3143	CLIP-seq
MIRT2600836	hsa-miR-3144-5p	CLIP-seq
MIRT2600837	hsa-miR-3148	CLIP-seq
MIRT2077405	hsa-miR-3187-5p	CLIP-seq
MIRT2600838	hsa-miR-3188	CLIP-seq
MIRT2600839	hsa-miR-3191	CLIP-seq
MIRT1262899	hsa-miR-3192	CLIP-seq
MIRT1262900	hsa-miR-331-3p	CLIP-seq
MIRT1262901	hsa-miR-340	CLIP-seq
MIRT1262904	hsa-miR-3612	CLIP-seq
MIRT2077406	hsa-miR-3618	CLIP-seq
MIRT1262907	hsa-miR-3619-5p	CLIP-seq
MIRT2600840	hsa-miR-3621	CLIP-seq
MIRT2600841	hsa-miR-3622a-3p	CLIP-seq
MIRT2600842	hsa-miR-3622a-5p	CLIP-seq
MIRT2600843	hsa-miR-3622b-3p	CLIP-seq
MIRT2303945	hsa-miR-3650	CLIP-seq
MIRT1262908	hsa-miR-3655	CLIP-seq
MIRT2600844	hsa-miR-3661	CLIP-seq
MIRT2600845	hsa-miR-3673	CLIP-seq
MIRT2457161	hsa-miR-3675-3p	CLIP-seq
MIRT1262909	hsa-miR-3689a-3p	CLIP-seq
MIRT1262910	hsa-miR-3689c	CLIP-seq
MIRT1262911	hsa-miR-3689d	CLIP-seq
MIRT2600846	hsa-miR-3690	CLIP-seq
MIRT1262912	hsa-miR-371-5p	CLIP-seq
MIRT2600847	hsa-miR-378g	CLIP-seq
MIRT1262913	hsa-miR-381	CLIP-seq
MIRT2600848	hsa-miR-3911	CLIP-seq
MIRT1262914	hsa-miR-3913-5p	CLIP-seq
MIRT1262916	hsa-miR-3921	CLIP-seq
MIRT1262919	hsa-miR-3929	CLIP-seq
MIRT2600849	hsa-miR-3937	CLIP-seq
MIRT2600850	hsa-miR-3938	CLIP-seq
MIRT2600851	hsa-miR-3941	CLIP-seq
MIRT2600852	hsa-miR-410	CLIP-seq
MIRT1262921	hsa-miR-412	CLIP-seq
MIRT1262922	hsa-miR-424	CLIP-seq
MIRT2393017	hsa-miR-4254	CLIP-seq
MIRT2688629	hsa-miR-4259	CLIP-seq
MIRT1262923	hsa-miR-4261	CLIP-seq
MIRT1262925	hsa-miR-4269	CLIP-seq
MIRT2600853	hsa-miR-4273	CLIP-seq
MIRT2600854	hsa-miR-4279	CLIP-seq
MIRT2303949	hsa-miR-4282	CLIP-seq
MIRT2600855	hsa-miR-4288	CLIP-seq
MIRT2303950	hsa-miR-4292	CLIP-seq
MIRT2600856	hsa-miR-4299	CLIP-seq
MIRT1262927	hsa-miR-4302	CLIP-seq
MIRT2600857	hsa-miR-4303	CLIP-seq
MIRT2077407	hsa-miR-4308	CLIP-seq
MIRT2600858	hsa-miR-433	CLIP-seq
MIRT1262930	hsa-miR-4419b	CLIP-seq
MIRT2077409	hsa-miR-4423-3p	CLIP-seq
MIRT1262931	hsa-miR-4427	CLIP-seq
MIRT2600859	hsa-miR-4449	CLIP-seq
MIRT2600860	hsa-miR-4456	CLIP-seq
MIRT1262933	hsa-miR-4478	CLIP-seq
MIRT1262934	hsa-miR-4496	CLIP-seq
MIRT1262938	hsa-miR-4514	CLIP-seq
MIRT2393020	hsa-miR-452	CLIP-seq
MIRT1262939	hsa-miR-4524	CLIP-seq
MIRT1262940	hsa-miR-4530	CLIP-seq
MIRT1262941	hsa-miR-4537	CLIP-seq
MIRT2600861	hsa-miR-4643	CLIP-seq
MIRT1262942	hsa-miR-4649-3p	CLIP-seq
MIRT2600862	hsa-miR-4652-5p	CLIP-seq
MIRT1262943	hsa-miR-4653-5p	CLIP-seq
MIRT2600863	hsa-miR-466	CLIP-seq
MIRT2077411	hsa-miR-4667-5p	CLIP-seq
MIRT2077412	hsa-miR-4668-3p	CLIP-seq
MIRT2600864	hsa-miR-4671-5p	CLIP-seq
MIRT2600865	hsa-miR-4672	CLIP-seq
MIRT2393021	hsa-miR-4676-3p	CLIP-seq
MIRT2077414	hsa-miR-4677-5p	CLIP-seq
MIRT1262945	hsa-miR-4680-3p	CLIP-seq
MIRT2600866	hsa-miR-4682	CLIP-seq
MIRT2600867	hsa-miR-4683	CLIP-seq
MIRT2077416	hsa-miR-4684-5p	CLIP-seq
MIRT2600868	hsa-miR-4685-5p	CLIP-seq
MIRT2688630	hsa-miR-4686	CLIP-seq
MIRT2688631	hsa-miR-4691-5p	CLIP-seq
MIRT1262946	hsa-miR-4692	CLIP-seq
MIRT1262947	hsa-miR-4694-3p	CLIP-seq
MIRT2600869	hsa-miR-4694-5p	CLIP-seq
MIRT2600870	hsa-miR-4697-3p	CLIP-seq
MIRT1262948	hsa-miR-4698	CLIP-seq
MIRT2077417	hsa-miR-4700-5p	CLIP-seq
MIRT2600872	hsa-miR-4714-3p	CLIP-seq
MIRT2303956	hsa-miR-4716-5p	CLIP-seq
MIRT1262950	hsa-miR-4722-5p	CLIP-seq
MIRT739868	hsa-miR-4726-3p	CLIP-seq
MIRT1262951	hsa-miR-4728-5p	CLIP-seq
MIRT1262952	hsa-miR-4738-3p	CLIP-seq
MIRT2303959	hsa-miR-4757-5p	CLIP-seq
MIRT2600873	hsa-miR-4761-3p	CLIP-seq
MIRT1262954	hsa-miR-4761-5p	CLIP-seq
MIRT2077420	hsa-miR-4762-3p	CLIP-seq
MIRT2077421	hsa-miR-4766-5p	CLIP-seq
MIRT1262956	hsa-miR-4768-3p	CLIP-seq
MIRT2077422	hsa-miR-4777-5p	CLIP-seq
MIRT1262959	hsa-miR-4782-3p	CLIP-seq
MIRT2600874	hsa-miR-4783-3p	CLIP-seq
MIRT2600875	hsa-miR-4789-3p	CLIP-seq
MIRT2600876	hsa-miR-4789-5p	CLIP-seq
MIRT2600877	hsa-miR-4790-3p	CLIP-seq
MIRT2600878	hsa-miR-4799-5p	CLIP-seq
MIRT2600879	hsa-miR-4800-3p	CLIP-seq
MIRT1262964	hsa-miR-483-3p	CLIP-seq
MIRT2393023	hsa-miR-485-3p	CLIP-seq
MIRT1262965	hsa-miR-485-5p	CLIP-seq
MIRT1262966	hsa-miR-490-3p	CLIP-seq
MIRT2077423	hsa-miR-494	CLIP-seq
MIRT1262968	hsa-miR-497	CLIP-seq
MIRT2077424	hsa-miR-500a	CLIP-seq
MIRT1262969	hsa-miR-503	CLIP-seq
MIRT2077425	hsa-miR-508-3p	CLIP-seq
MIRT2600880	hsa-miR-5095	CLIP-seq
MIRT2600881	hsa-miR-513a-3p	CLIP-seq
MIRT2077426	hsa-miR-518d-5p	CLIP-seq
MIRT2077427	hsa-miR-519b-5p	CLIP-seq
MIRT2077428	hsa-miR-519c-5p	CLIP-seq
MIRT2077429	hsa-miR-520c-5p	CLIP-seq
MIRT1262970	hsa-miR-522	CLIP-seq
MIRT2077430	hsa-miR-526a	CLIP-seq
MIRT1262971	hsa-miR-543	CLIP-seq
MIRT2600882	hsa-miR-548ac	CLIP-seq
MIRT2600883	hsa-miR-548ae	CLIP-seq
MIRT2600884	hsa-miR-548aj	CLIP-seq
MIRT2600885	hsa-miR-548am	CLIP-seq
MIRT2600886	hsa-miR-548c-3p	CLIP-seq
MIRT2600887	hsa-miR-548d-3p	CLIP-seq
MIRT1262972	hsa-miR-548q	CLIP-seq
MIRT2600888	hsa-miR-548x	CLIP-seq
MIRT2600889	hsa-miR-548z	CLIP-seq
MIRT2077433	hsa-miR-563	CLIP-seq
MIRT2600890	hsa-miR-571	CLIP-seq
MIRT2600892	hsa-miR-600	CLIP-seq
MIRT2077435	hsa-miR-612	CLIP-seq
MIRT2600893	hsa-miR-618	CLIP-seq
MIRT2600894	hsa-miR-626	CLIP-seq
MIRT2600895	hsa-miR-631	CLIP-seq
MIRT2600896	hsa-miR-632	CLIP-seq
MIRT2600897	hsa-miR-635	CLIP-seq
MIRT2600898	hsa-miR-644	CLIP-seq
MIRT1262978	hsa-miR-646	CLIP-seq
MIRT1262979	hsa-miR-650	CLIP-seq
MIRT2600900	hsa-miR-670	CLIP-seq
MIRT1262982	hsa-miR-758	CLIP-seq
MIRT1262983	hsa-miR-761	CLIP-seq
MIRT2600901	hsa-miR-769-5p	CLIP-seq
MIRT2077437	hsa-miR-890	CLIP-seq
MIRT1262985	hsa-miR-922	CLIP-seq
MIRT2077438	hsa-miR-934	CLIP-seq
MIRT2600902	hsa-miR-936	CLIP-seq
MIRT1262986	hsa-miR-940	CLIP-seq
MIRT2688632	hsa-miR-944	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
RARA	Activation	11525643
TFAP2A	Activation	12269829

109

Show/Hide all (109)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000302	Process	Response to reactive oxygen species	IEA
GO:0001525	Process	Angiogenesis	IEA
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IMP	11909826
GO:0002159	Process	Desmosome assembly	IMP	18474624
GO:0004672	Function	Protein kinase activity	IDA	10770950
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004697	Function	Diacylglycerol-dependent serine/threonine kinase activity	EXP	7520444, 7539802, 12391145, 17392515
GO:0004697	Function	Diacylglycerol-dependent serine/threonine kinase activity	IEA
GO:0004697	Function	Diacylglycerol-dependent serine/threonine kinase activity	TAS	3755548
GO:0004698	Function	Calcium,diacylglycerol-dependent serine/threonine kinase activity	IDA	25313067
GO:0004698	Function	Calcium,diacylglycerol-dependent serine/threonine kinase activity	IEA
GO:0004698	Function	Calcium,diacylglycerol-dependent serine/threonine kinase activity	IMP	33934390
GO:0004698	Function	Calcium,diacylglycerol-dependent serine/threonine kinase activity	ISS
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005178	Function	Integrin binding	ISS
GO:0005515	Function	Protein binding	IPI	12571249, 12893243, 16810323, 17244820, 18566587, 21703451, 21952047, 24658140, 28514442, 30017192, 31980649, 32707033, 32814053, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	15632189, 23990668
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HDA	20833797
GO:0005739	Component	Mitochondrion	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA	18556656
GO:0005829	Component	Cytosol	IDA	17983652
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	ISS
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA	15632189, 23990668
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006338	Process	Chromatin remodeling	IEA
GO:0006468	Process	Protein phosphorylation	IDA	10770950
GO:0006915	Process	Apoptotic process	IEA
GO:0007077	Process	Mitotic nuclear membrane disassembly	IEA
GO:0007077	Process	Mitotic nuclear membrane disassembly	TAS
GO:0007155	Process	Cell adhesion	IEA
GO:0007611	Process	Learning or memory	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0009612	Process	Response to mechanical stimulus	IEA
GO:0009636	Process	Response to toxic substance	IEA
GO:0009967	Process	Positive regulation of signal transduction	IEA
GO:0010595	Process	Positive regulation of endothelial cell migration	IMP	11909826
GO:0010613	Process	Positive regulation of cardiac muscle hypertrophy	IEA
GO:0010613	Process	Positive regulation of cardiac muscle hypertrophy	ISS
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0017148	Process	Negative regulation of translation	IEA
GO:0019899	Function	Enzyme binding	IPI	18556656
GO:0019992	Function	Diacylglycerol binding	TAS
GO:0021955	Process	Central nervous system neuron axonogenesis	IEA
GO:0023019	Process	Signal transduction involved in regulation of gene expression	IDA	24298024
GO:0030335	Process	Positive regulation of cell migration	IMP	23990668
GO:0031666	Process	Positive regulation of lipopolysaccharide-mediated signaling pathway	IMP	9830023
GO:0031966	Component	Mitochondrial membrane	IEA
GO:0032024	Process	Positive regulation of insulin secretion	TAS
GO:0032355	Process	Response to estradiol	IEA
GO:0032991	Component	Protein-containing complex	IEA
GO:0034351	Process	Negative regulation of glial cell apoptotic process	IMP	9927633
GO:0035403	Function	Histone H3T6 kinase activity	IDA	20228790
GO:0035403	Function	Histone H3T6 kinase activity	IEA
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0035866	Component	Alphav-beta3 integrin-PKCalpha complex	ISS
GO:0036064	Component	Ciliary basal body	IDA	33934390
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	23453970, 35093948
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IMP	33934390
GO:0043434	Process	Response to peptide hormone	IEA
GO:0043488	Process	Regulation of mRNA stability	TAS
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	24298024
GO:0043536	Process	Positive regulation of blood vessel endothelial cell migration	IDA	20011604
GO:0045471	Process	Response to ethanol	IEA
GO:0045651	Process	Positive regulation of macrophage differentiation	ISS
GO:0045766	Process	Positive regulation of angiogenesis	IMP	11909826
GO:0045780	Process	Positive regulation of bone resorption	ISS
GO:0045785	Process	Positive regulation of cell adhesion	IMP	11909826
GO:0045921	Process	Positive regulation of exocytosis	IEA
GO:0045931	Process	Positive regulation of mitotic cell cycle	IMP	10848585
GO:0046872	Function	Metal ion binding	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	ISS
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IEA
GO:0051049	Process	Regulation of transport	IEA
GO:0051412	Process	Response to corticosterone	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	ISS
GO:0051965	Process	Positive regulation of synapse assembly	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0070294	Process	Renal sodium ion absorption	IDA	35093948
GO:0070294	Process	Renal sodium ion absorption	ISS	14608358, 17975670
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IEA
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	ISS
GO:0070528	Process	Protein kinase C signaling	IDA	20228790
GO:0070528	Process	Protein kinase C signaling	IEA
GO:0070555	Process	Response to interleukin-1	IMP	19281832
GO:0090330	Process	Regulation of platelet aggregation	IDA	12724315
GO:0097190	Process	Apoptotic signaling pathway	TAS	10825394
GO:0106071	Process	Positive regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway	ISS
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0110063	Process	Positive regulation of angiotensin-activated signaling pathway	IDA	25313067
GO:1900016	Process	Negative regulation of cytokine production involved in inflammatory response	IDA	24298024
GO:1900016	Process	Negative regulation of cytokine production involved in inflammatory response	ISS
GO:1900016	Process	Negative regulation of cytokine production involved in inflammatory response	ISS
GO:1900017	Process	Positive regulation of cytokine production involved in inflammatory response	ISS
GO:1904627	Process	Response to phorbol 13-acetate 12-myristate	IEA
GO:2000707	Process	Positive regulation of dense core granule biogenesis	ISS

MIM	HGNC	e!Ensembl
176960	9393	ENSG00000154229

P17252

Protein name

Protein kinase C alpha type (PKC-A) (PKC-alpha) (EC 2.7.11.13)

Protein function

Calcium-activated, phospholipid- and diacylglycerol (DAG)-dependent serine/threonine-protein kinase that is involved in positive and negative regulation of cell proliferation, apoptosis, differentiation, migration and adhesion, tumorigenesis, ca

PDB

2ELI , 3IW4 , 4DNL , 4RA4 , 8U37 , 8UAK

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00130	C1_1	37 → 89	Phorbol esters/diacylglycerol binding domain (C1 domain)	Domain
PF00130	C1_1	102 → 154	Phorbol esters/diacylglycerol binding domain (C1 domain)	Domain
PF00168	C2	171 → 277	C2 domain	Domain
PF00069	Pkinase	339 → 597	Protein kinase domain	Domain
PF00433	Pkinase_C	623 → 658	Protein kinase C terminal domain	Family

Sequence

MADVFPGNDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGS
LLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVADEKLHVTVRDA
KNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRL
SVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNME
LRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKG
TEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYV
NGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIA
DFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDG
EDEDELFQSIMEHNVSYPKSLSKEAVSVCKGLMTKHPAKRLGCGPEGERDVREHAFFRRI
DWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVN
PQFVHPILQSAV

Sequence length

672

Interactions

View interactions

	KEGG		Reactome
	EGFR tyrosine kinase inhibitor resistance MAPK signaling pathway ErbB signaling pathway Ras signaling pathway Rap1 signaling pathway Calcium signaling pathway HIF-1 signaling pathway Phosphatidylinositol signaling system Sphingolipid signaling pathway Phospholipase D signaling pathway mTOR signaling pathway PI3K-Akt signaling pathway Adrenergic signaling in cardiomyocytes Vascular smooth muscle contraction Wnt signaling pathway Axon guidance VEGF signaling pathway Focal adhesion Gap junction Neutrophil extracellular trap formation Natural killer cell mediated cytotoxicity Fc epsilon RI signaling pathway Fc gamma R-mediated phagocytosis Leukocyte transendothelial migration Circadian entrainment Long-term potentiation Retrograde endocannabinoid signaling Glutamatergic synapse Cholinergic synapse Serotonergic synapse GABAergic synapse Dopaminergic synapse Long-term depression Inflammatory mediator regulation of TRP channels Insulin secretion GnRH signaling pathway Melanogenesis Thyroid hormone synthesis Thyroid hormone signaling pathway Oxytocin signaling pathway Aldosterone synthesis and secretion Relaxin signaling pathway Parathyroid hormone synthesis, secretion and action GnRH secretion AGE-RAGE signaling pathway in diabetic complications Growth hormone synthesis, secretion and action Aldosterone-regulated sodium reabsorption Endocrine and other factor-regulated calcium reabsorption Salivary secretion Gastric acid secretion Pancreatic secretion Spinocerebellar ataxia Pathways of neurodegeneration - multiple diseases Amphetamine addiction Morphine addiction Vibrio cholerae infection African trypanosomiasis Amoebiasis Hepatitis B Human cytomegalovirus infection Influenza A Human immunodeficiency virus 1 infection Coronavirus disease - COVID-19 Pathways in cancer Proteoglycans in cancer MicroRNAs in cancer Chemical carcinogenesis - receptor activation Glioma Non-small cell lung cancer Hepatocellular carcinoma Choline metabolism in cancer Diabetic cardiomyopathy Lipid and atherosclerosis		Calmodulin induced events Disinhibition of SNARE formation SHC1 events in ERBB2 signaling Signaling by SCF-KIT Regulation of KIT signaling EGFR Transactivation by Gastrin Syndecan interactions Acetylcholine regulates insulin secretion Trafficking of GluR2-containing AMPA receptors Depolymerisation of the Nuclear Lamina HuR (ELAVL1) binds and stabilizes mRNA WNT5A-dependent internalization of FZD4 VEGFR2 mediated cell proliferation RHO GTPases Activate NADPH Oxidases Response to elevated platelet cytosolic Ca2+ RET signaling ROBO receptors bind AKAP5

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (27)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA, OCCUPATIONAL	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRUGADA SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMEGALY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, DILATED	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CRYPTOSPORIDIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES INSIPIDUS, NEPHROGENIC	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DILATED CARDIOMYOPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMORRHOID	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHIC CARDIOMYOPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTESTINAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROGENIC DIABETES INSIPIDUS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONALCOHOLIC STEATOHEPATITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONORGANIC PSYCHOSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POST-TRAUMATIC STRESS DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRKCA-related disorder	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHOTIC DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOAFFECTIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (402)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acne	Acne	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Acquired Nephrogenic Diabetes Insipidus	Diabetes Insipidus	CTD_human_DG	25006961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acth-Independent Macronodular Adrenal Hyperplasia	Cushing`s Syndrome	BEFREE	31276155		★★★★★ ★☆☆☆☆ Found in Text Mining only
ACTH-Secreting Pituitary Adenoma	Pituitary adenoma	BEFREE	26701869		★★★★★ ★☆☆☆☆ Found in Text Mining only
Actinic keratosis	Actinic keratosis	BEFREE	30944245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	24990612		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	20200558		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	23604119, 28751441, 31420605, 31612005		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	30904392		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	21406403		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	23604119, 24571724, 25057884, 25069672, 25750087, 26038203, 26139209, 27015136, 27270477, 27296931, 27454103, 28405879, 31276155		★★★★★ ★☆☆☆☆ Found in Text Mining only
ADH-Resistant Diabetes Insipidus	Nephrogenic Diabetes Insipidus	CTD_human_DG	25006961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Cancer	Adrenal Cancer	CTD_human_DG	24747643		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Cortical Adenoma	Adrenocortical adenoma	BEFREE	24700472, 24855271, 25057884, 26139209, 26701869, 27389594, 27606678, 28369983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Gland Neoplasms	Adrenal neoplasia	CTD_human_DG	24747643		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal hyperplasia	Adrenal hyperplasia	BEFREE	25750087, 26130139		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal hyperplasia	Adrenal hyperplasia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	26739091, 27296931		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	32875319, 37895143	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	23557915		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	26739091		★★★★★ ★☆☆☆☆ Found in Text Mining only
AL-RAQAD SYNDROME	AL-Raqad Syndrome	BEFREE	15751970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	18336728, 22982105, 37010714	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	29050205		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	29266405, 31817487		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	31051220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Angina Stable	Angina pectoris	Pubtator	32154962	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	31678302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic coarctation	Aortic Coarctation	BEFREE	30970525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aphakia congenital primary	Congenital primary aphakia	Pubtator	25069672	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	26739091		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	29177114		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	14719189, 31385361		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	17530707	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Gouty	Gouty arthritis	GWASCAT_DG	22179738		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	19576566, 20426528, 27504716	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	20816195, 22830352, 28448991		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma, Occupational	Asthma	CTD_human_DG	27504716		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	Pubtator	11483662	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	25514083		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	29177114		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial cardiomyopathy	Atrial cardiomyopathy	BEFREE	31735076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	30496756		★★★★★ ★☆☆☆☆ Found in Text Mining only
ATRICHIA WITH PAPULAR LESIONS	Atrichia With Papular Lesions	BEFREE	20200558		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	26749308	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	21983831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Axenfeld-Rieger syndrome	Axenfeld anomaly	BEFREE	15751970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	29257318	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Basal cell carcinoma	Carcinoma	LHGDN	12907651		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bile Duct Diseases	Bile duct disease	Pubtator	31678302	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	25752336, 28629334		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	28585865		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	29476136		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12841677, 15459489, 16166314, 17061041, 19454617, 20099025, 21720730, 22427054, 22911661, 24366551, 24909179, 25064703, 26806619, 28190385, 28515445 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12138200, 12379472, 12778068, 19324060, 19406749, 19454617, 20398285, 21712053, 21720730, 22464443, 24029232, 24909179, 29216867, 30091186, 33785524 View all (6 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	21665913	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	1712443		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	25225290, 26121314, 39596225	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	22969158, 25698061, 27015136, 28862261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	17050668, 20444294, 26010542, 27029710, 27831650, 31862487, 37119001, 37596321	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of ampulla of Vater	Ampullary Carcinoma	BEFREE	28389139		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	24316392, 25752336, 28629334, 8758918		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	18632643, 24040137, 25724832, 28122729, 29312551		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	20459627, 23526078, 28629334	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	28204826	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	23098446, 23843242, 27554045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	20689063, 29234372		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	37852321	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	24116014, 32916098	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	29540468		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, FAMILIAL RESTRICTIVE, 1 (disorder)	Cardiomyopathy	BEFREE	27557662		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	29864522		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carney Complex	Carney complex	Pubtator	29222914	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
CATARACT, MARNER TYPE	Cataract	BEFREE	10082134		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	11642552		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	20938215	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	CTD_human_DG	26258846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	28500348		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	20178602	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	30455396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	12737946, 25616575, 26910488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Pain	Chronic pain	Pubtator	28051079	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ciliopathies	Ciliopathy	Pubtator	33875766	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	32875319	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	21281445		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	21281445	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	37107586	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	19232344, 19506549, 19833168, 22543197, 22639047, 23233043, 24914206, 25366420, 29637628, 31109112		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	11451996, 9823967	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	7999261, 8404381		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	11839557, 22543197, 25366420, 29408512, 30298093, 31109112, 31810137, 8404381		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	20122401, 22639047, 23233043, 23616010, 29794421, 31160710, 35836259, 36791912	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	20141613	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conduction disorder of the heart	Conduction Disorder Of The Heart	BEFREE	19907076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital adrenal hyperplasia	Congenital adrenal hyperplasia	BEFREE	25750087, 26130139		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital adrenal hyperplasia	Congenital adrenal hyperplasia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	25557953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of lung	Pulmonary hypoplasia	BEFREE	30923343		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Nephrogenic Diabetes Insipidus	Nephrogenic Diabetes Insipidus	CTD_human_DG	25006961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	11709417, 20937286, 21666110, 27353086, 28120175, 28629760, 29333637, 29396114, 31728800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conn Syndrome	Conn Syndrome	BEFREE	27270477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	21233420, 22429968, 23526078, 27666332, 28565866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	29654769		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniosynostoses	Craniosynostosis	Pubtator	10329600	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	17522815	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	26215868		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cryptosporidiosis	Cryptosporidiosis	Pubtator	32019797	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cushing Syndrome	Cushing`s Syndrome	BEFREE	24571724, 24855271, 25057884, 25069672, 25449630, 25750087, 25924874, 26130139, 26139209, 27296931, 27389594, 27454103, 30615103, 31276155		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cushing Syndrome	Cushing syndrome	Pubtator	24571724, 24747643, 25069672, 25449630, 25924874, 27165862, 31489371, 34224748, 34520814, 34534321, 35216289, 37306403	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	27349634		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	19573263	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic 1	Atopic dermatitis	Pubtator	20426528	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatofibrosarcoma Protuberans	Dermatofibrosarcoma Protuberans	BEFREE	14633610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	23557915		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	24505490, 29234372, 31743046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	33890634	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	18758661, 22828147	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	22965996	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	24505490, 28826907, 29234372, 29760016, 31743046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	33827531	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	27865779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	14636302, 29760016, 30692925, 31520154		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	18758661	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	21321125, 29770444, 31817632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	21254925, 30930967		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diarrhea	Diarrhea	Pubtator	32019797	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	25589617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyskinetic syndrome	Dyskinetic Syndrome	BEFREE	10323309, 11346027		★★★★★ ★☆☆☆☆ Found in Text Mining only
EAR, PATELLA, SHORT STATURE SYNDROME	Ear Diseases	BEFREE	23157623		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	17965220	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	19235902, 30021163		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	22706224, 36791912	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	BEFREE	30021163		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	15299092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	29329108		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	38164831	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Episodic ataxia type 1	Episodic ataxia	BEFREE	11346027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Episodic Kinesigenic Dyskinesia 1	Episodic Kinesigenic Dyskinesia	BEFREE	18342628, 20158512, 28081739, 28188686, 31373844, 31745212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	28402280, 28771997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	28402280, 28771997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	30450849	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophagitis	Esophagitis	BEFREE	28402280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	23753411	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	22930730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Extrahepatic Cholangiocarcinoma	Cholangiocarcinoma	CTD_human_DG	26258846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	BEFREE	10101252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrolamellar Hepatocellular Carcinoma	Hepatocellular Carcinoma	BEFREE	24578576, 25122662, 25557953, 25605237, 25698061, 26489647, 28304380, 28862261, 28923495, 30597357, 31669305, 31676785, 31736218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrolamellar Hepatocellular Carcinoma	Hepatocellular Carcinoma	ORPHANET_DG	24578576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrolamellar hepatocellular carcinoma	Hepatocellular Carcinoma	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	28286052		★★★★★ ★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	12951842		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	27323780		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	15095270, 18381383, 21358619, 23862765, 26243012, 27440273		★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Fibroblastoma	Giant Cell Fibroblastoma	BEFREE	14633610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	12269829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	16331246, 16832347, 18508315, 21040711, 21419810, 26234676, 27717886, 30849522, 31806641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	26940200, 33916643, 9634008	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	12269829, 16331246, 16832347, 21040711, 21419810, 26234676, 27717886, 30849522, 31806641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	10408397, 10848585, 15842253, 19176518, 19357285, 26502848, 28904974, 29476136, 29915258, 35361262	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	18508315, 20613874, 26502848, 27903982, 28904974, 31603255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	33885249	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	Pubtator	18758661	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	29731111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	30029622	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	20375117, 28539358		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Renal glycosuria	Pubtator	9497315	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gout	Gout	GWASCAT_DG	22179738		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	22969158	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	28120175, 29396114, 29540468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	28120175	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	11709417, 20937286, 21666110, 27353086, 28120175, 28629760, 29333637, 29396114, 31728800		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure	Heart failure	Pubtator	24116014, 28120175, 31728800	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Valve Diseases	Heart valve disease	Pubtator	34482802	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	16424642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemorrhoids	Hemorrhoid	Pubtator	37932969	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatic Fibrosis, Congenital	Congenital Hepatic Fibrosis	BEFREE	18949060		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	37272842	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Histiocytoma, Benign Fibrous	Benign fibrous histiocytoma	BEFREE	26121314		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	30347596	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	LHGDN	12960759		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	23896721		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hurthle Cell Tumor	Tumor	BEFREE	30116406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperaldosteronism	Hyperaldosteronism	Pubtator	25069672	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	10233166, 19279131, 21321125, 24936444, 28954262, 29477910, 30423260, 31743046, 31817632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	29032894, 29187383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemias	Hyperlipidemia	Pubtator	22819546	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperoxaluria	Hyperoxaluria	BEFREE	30020825		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism, Secondary	Hyperparathyroidism	BEFREE	28843775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	24571724, 25449630, 25924874	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	30036880, 31197021, 31733216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypocholesterolemia	Hypocholesterolemia	BEFREE	27866837		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypogonadism	Hypogonadism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypophosphatemic Rickets, X-Linked Dominant	Hypophosphatemic Rickets	BEFREE	31484825		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypotension	Hypotension	Pubtator	34825477	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothalamic hamartomas	Hypothalamic Hamartomas	BEFREE	27453577		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	10354503, 21720730	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	21281445, 29382817		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infantile convulsions and paroxysmal choreoathetosis, familial (disorder)	Infantile convulsions and choreoathetosis	BEFREE	11346027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	22830352, 30020825		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	30913280	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Cancer	Intestinal Cancer	CTD_human_DG	11983831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	CTD_human_DG	11983831		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	19232344		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	CTD_human_DG	26258846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	16166314		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	30411312		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Calculi	Kidney stone	BEFREE	30020825		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	28539358		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	30455396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	23526078	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	17588800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	27417454, 37932969	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	16763210, 24858343, 27417454, 32203165	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	16642043		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	17255356, 21360576, 24334295, 27417454, 29127121		★★★★★ ★☆☆☆☆ Found in Text Mining only
Linear atrophy	Atrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	11642408, 17593797, 22559731, 26010542, 26056003, 26437858, 26646106, 28110996, 28928894, 31543517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	26212029	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	31676785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Long QT Syndrome	Long qt syndrome	Pubtator	27988371	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	10375741, 15210690, 24040137, 25724832, 26498639, 27706607, 28204826, 28592245, 34427969, 37056937, 39630579, 7911467	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	23604119, 29312551		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	31401343		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	31401343		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	16431347, 31401343		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	18758661	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	31401343		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	20976278		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Bone Neoplasm	Malignant Bone Neoplasm	BEFREE	29428215		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12841677, 15459489, 16166314, 16408291, 17061041, 19454617, 20099025, 21720730, 22911661, 24366551, 24909179, 25064703, 26806619, 28190385, 28515445 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	19235902, 30021163		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	28402280, 28771997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	22429968		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	18632643, 24040137, 25724832, 28122729, 28928894, 29312551		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	8847210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	23098446, 23843242, 27554045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	19924022, 23389293, 28415683, 28826907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	18778896, 19483721, 21266973, 21406403, 26786102, 30226591, 31477269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	15057036, 22771957		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	31261030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	11994357		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	25752336, 28629334		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11190577, 12014641, 14565477, 15057036, 17061041, 18508315, 18632643, 18778896, 19099253, 19235902, 19795097, 22549737, 22773839, 23096778, 23389293 View all (25 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	19506549, 19833168, 22639047, 23233043, 24914206, 25366420, 29637628, 31109112, 9500474		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12490289, 12632071, 12878187, 15843433, 16939222, 17061041, 17171646, 18505929		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	20856202, 21665913, 22511072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	BEFREE	30981159		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	12839565		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	12839565, 1988168, 20520718, 21712053, 22773839, 25138157, 30543563, 30657954, 7678596	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	15057036, 18826602, 21389833, 22773839, 25712345, 30543563, 31356866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Membranous glomerulonephritis	Membranous Glomerulonephritis	LHGDN	16775601		★★★★★ ★☆☆☆☆ Found in Text Mining only
Memory Disorders	Memory disorders	Pubtator	21281445	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	19786960		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	26300055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	30913280	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	30913280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	29048609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood disorder	Pubtator	22166941	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood swings	Mood swings	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	11751905, 9217182	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	17714780, 22435755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	15155525, 16596167, 22830352, 25080502		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	16596167, 28051079, 34873174	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	30711624		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	28970249		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	30395882		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	30618318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	28777252, 31241168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	35432334	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	29654769		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial necrosis	Myocardial necrosis	BEFREE	28777252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	28903333		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	LHGDN	15159477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	BEFREE	17936705, 19907076, 24179176, 24878509		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	17936705		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myxoma of heart	Myxoma Of Heart	BEFREE	28369983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myxoma of the Endocardium	Myxoma Of The Endocardium	BEFREE	28369983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	28084179, 30809095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10593857, 11190577, 15057036, 15095270, 15459489, 16166314, 16408291, 18508315, 18632643, 18778896, 19235902, 20727927, 21088903, 21310943, 21822543 View all (43 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	16955103, 23604119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrogenic Diabetes Insipidus	Nephrogenic Diabetes Insipidus	CTD_human_DG	25006961		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nephrogenic Diabetes Insipidus, Type I	Nephrogenic Diabetes Insipidus	CTD_human_DG	25006961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrogenic Diabetes Insipidus, Type II	Nephrogenic Diabetes Insipidus	CTD_human_DG	25006961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrolithiasis	Nephrolithiasis	BEFREE	30020825		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	28482641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	16080189, 22371354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural tube defect	Pubtator	16080189	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	12716436, 15277524, 2013316	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	14655750, 18991684, 2013316, 21315177, 21403388, 21716262		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	8344386	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	29329108		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	CTD_human_DG	29341352		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	30573200, 30692925, 30773673		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	15555220, 18632643, 21448905, 23303128, 23604119, 30923343, 31261030, 31410027, 31420605, 31576014		★★★★★ ★☆☆☆☆ Found in Text Mining only
NONAKA MYOPATHY	Inclusion body myopathy	BEFREE	16832347		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	CTD_human_DG	29341352		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonorganic psychosis	Nonorganic Psychosis	PSYGENET_DG	19786960		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	22166941, 36194662	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	28585197, 31630415		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ocular Hypertension	Ocular Hypertension	BEFREE	31787761		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Atrophy 1	Optic Atrophy	BEFREE	30112072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	34856957	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	19609857, 28339053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	32847038	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	27554045		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	15905176, 17341442, 17724468		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	23098446, 23843242		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	14716767, 17724468, 23098446, 35464051, 37522200	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oxyphilic Adenoma	Oxyphilic Adenoma	BEFREE	30116406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	19924022, 23389293, 28415683, 28826907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Cyst	Pancreatic cyst	Pubtator	31678302	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Diseases	Pancreatic Diseases	BEFREE	28826907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	18239055, 20684793, 30904392, 31676785, 31678302, 32367578	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	28826907		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	28178642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papilloma Choroid Plexus	Choroid plexus papilloma	Pubtator	33249490	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	30867898		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	BEFREE	24711455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pemphigus Foliaceus	Pemphigus Foliaceus	BEFREE	28620161		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pemphigus Vulgaris	Pemphigus Vulgaris	BEFREE	25010392		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral demyelinating neuropathy	Demyelinating neuropathy	BEFREE	11673479		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	11673479, 30926374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	11673479, 30926374		★★★★★ ★☆☆☆☆ Found in Text Mining only
PIGMENTED NODULAR ADRENOCORTICAL DISEASE, PRIMARY, 4	Pigmented Nodular Adrenocortical Disease	UNIPROT_DG	24571724, 24700472, 24747643, 24855271		★★★★★ ★☆☆☆☆ Found in Text Mining only
PIGMENTED NODULAR ADRENOCORTICAL DISEASE, PRIMARY, 4	Pigmented Nodular Adrenocortical Disease	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
PIGMENTED NODULAR ADRENOCORTICAL DISEASE, PRIMARY, 4	Pigmented Nodular Adrenocortical Disease	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Diseases	Pituitary Diseases	BEFREE	31276155		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	18949060		★★★★★ ★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	22586106, 25219830		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prader-Willi Syndrome	Prader-Willi Syndrome	BEFREE	28030367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	LHGDN	17895245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	27644318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary hypercortisolism	Hypercortisolism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary pigmented nodular adrenocortical disease	Pigmented Nodular Adrenocortical Disease	ORPHANET_DG	24571724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary pigmented nodular adrenocortical disease	Pigmented Nodular Adrenocortical Disease	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	BEFREE	21753881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	18778896, 19483721, 21266973, 21406403, 26786102, 30226591, 31477269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	12824193, 16751804, 16979586		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	12824193, 19029835, 19117992, 23826267, 37385990, 39341147	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21266973	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	PSYGENET_DG	19786960		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	28901444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	22192844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	28565866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	21233420, 22429968, 23526078, 28565866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	29794026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	31209984		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	17122966, 18632643, 22830352, 31385361		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	15563462, 18507025, 38478639	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	19609943	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizoaffective Disorder	Schizoaffective Disorder	PSYGENET_DG	19786960		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	19786960, 21281445		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	19786960, 21281445		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	21281445	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scleroderma	Scleroderma	BEFREE	16447227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	29617417, 30112072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Acute Respiratory Syndrome	Severe Acute Respiratory Syndrome	BEFREE	19112100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	LHGDN	18401527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	18401527	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spina Bifida	Spina Bifida	LHGDN	16080189		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	16374540, 8847210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	27481515, 31409639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	37082943	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	21735098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	30573200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	17393422, 23468872, 31261030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	12046066, 14606067, 20428959, 24260584, 31399040	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	14606067		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	23468872	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	16447227		★★★★★ ★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	22559731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	39258697	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	11994357		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	11994357		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	39596225	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	22559731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	24029232, 24925028, 27542222, 28388298, 28515445, 29216867		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	24029232, 27542222	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tumors of Adrenal Cortex	Tumors Of Adrenal Cortex	BEFREE	8969921		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uremia	Uremia	BEFREE	28485503		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	17957529, 24528886, 25752336, 28629334, 32802870, 33452764, 33830879	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	32141538	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Neoplasms	Uterine neoplasm	Pubtator	36791912	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	22653968	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	24413085, 30525429		★★★★★ ★☆☆☆☆ Found in Text Mining only
Varicosity	Vulval varices	BEFREE	27980071		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	19955485		★★★★★ ★☆☆☆☆ Found in Text Mining only
Venous Thrombosis	Venous thrombosis	Pubtator	37466160	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Septal Defects	Ventricular septal defect	BEFREE	28822034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitamin D-Resistant Rickets, X-Linked	Vitamin D-Dependent Rickets	BEFREE	31484825		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitreoretinopathy Proliferative	Vitreoretinopathy	Pubtator	21753881	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Wieacker syndrome	Wieacker syndrome	Pubtator	27070589	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

PRKCA (protein kinase C alpha)