PRKAR2B (protein kinase cAMP-dependent type II regulatory subunit beta)

Gene

• Entrez ID: 5577
• Gene name: Protein kinase cAMP-dependent type II regulatory subunit beta
• Gene symbol: PRKAR2B
• Synonyms (NCBI Gene): PRKAR2, RII-BETA
• Chromosome: 7
• Chromosome location: 7q22.3
• Summary: cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins. The inactive kinase holo

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016228	hsa-miR-590-3p	Sequencing	20371350
MIRT1262833	hsa-miR-1272	CLIP-seq
MIRT1262834	hsa-miR-1305	CLIP-seq
MIRT1262835	hsa-miR-150	CLIP-seq
MIRT1262836	hsa-miR-188-3p	CLIP-seq
MIRT1262837	hsa-miR-2681	CLIP-seq
MIRT1262838	hsa-miR-296-3p	CLIP-seq
MIRT1262839	hsa-miR-2964a-3p	CLIP-seq
MIRT1262840	hsa-miR-297	CLIP-seq
MIRT1262841	hsa-miR-3140-3p	CLIP-seq
MIRT1262842	hsa-miR-3174	CLIP-seq
MIRT1262843	hsa-miR-3609	CLIP-seq
MIRT1262844	hsa-miR-361-5p	CLIP-seq
MIRT1262845	hsa-miR-3924	CLIP-seq
MIRT1262846	hsa-miR-4282	CLIP-seq
MIRT1262847	hsa-miR-431	CLIP-seq
MIRT1262848	hsa-miR-4643	CLIP-seq
MIRT1262849	hsa-miR-4653-3p	CLIP-seq
MIRT1262850	hsa-miR-4704-3p	CLIP-seq
MIRT1262851	hsa-miR-4713-5p	CLIP-seq
MIRT1262852	hsa-miR-4775	CLIP-seq
MIRT1262853	hsa-miR-4781-3p	CLIP-seq
MIRT1262854	hsa-miR-516b	CLIP-seq
MIRT1262855	hsa-miR-518a-5p	CLIP-seq
MIRT1262856	hsa-miR-520d-5p	CLIP-seq
MIRT1262857	hsa-miR-524-5p	CLIP-seq
MIRT1262858	hsa-miR-527	CLIP-seq
MIRT1262859	hsa-miR-532-3p	CLIP-seq
MIRT1262860	hsa-miR-548ah	CLIP-seq
MIRT1262861	hsa-miR-548c-3p	CLIP-seq
MIRT1262862	hsa-miR-552	CLIP-seq
MIRT1262863	hsa-miR-567	CLIP-seq
MIRT1262864	hsa-miR-606	CLIP-seq
MIRT1262865	hsa-miR-944	CLIP-seq
MIRT1262847	hsa-miR-431	CLIP-seq
MIRT2077392	hsa-miR-4318	CLIP-seq
MIRT2077393	hsa-miR-4693-5p	CLIP-seq
MIRT1262852	hsa-miR-4775	CLIP-seq
MIRT1262862	hsa-miR-552	CLIP-seq
MIRT2077394	hsa-miR-668	CLIP-seq
MIRT2077395	hsa-miR-892a	CLIP-seq
MIRT1262844	hsa-miR-361-5p	CLIP-seq
MIRT2303921	hsa-miR-3651	CLIP-seq
MIRT2303922	hsa-miR-3973	CLIP-seq
MIRT2303923	hsa-miR-3974	CLIP-seq
MIRT2303924	hsa-miR-4427	CLIP-seq
MIRT2303925	hsa-miR-4477a	CLIP-seq
MIRT2303926	hsa-miR-4680-3p	CLIP-seq
MIRT2303927	hsa-miR-491-3p	CLIP-seq
MIRT2303928	hsa-miR-520g	CLIP-seq
MIRT2303929	hsa-miR-520h	CLIP-seq
MIRT2303930	hsa-miR-622	CLIP-seq
MIRT2432273	hsa-miR-3065-5p	CLIP-seq
MIRT2432274	hsa-miR-3121-3p	CLIP-seq
MIRT2303927	hsa-miR-491-3p	CLIP-seq
MIRT2432275	hsa-miR-577	CLIP-seq
MIRT2600793	hsa-miR-137	CLIP-seq
MIRT2600794	hsa-miR-217	CLIP-seq
MIRT2600795	hsa-miR-25	CLIP-seq
MIRT2432273	hsa-miR-3065-5p	CLIP-seq
MIRT2600796	hsa-miR-3117-3p	CLIP-seq
MIRT2600797	hsa-miR-3163	CLIP-seq
MIRT2600798	hsa-miR-3169	CLIP-seq
MIRT2600799	hsa-miR-32	CLIP-seq
MIRT2600800	hsa-miR-3618	CLIP-seq
MIRT2600801	hsa-miR-363	CLIP-seq
MIRT2600802	hsa-miR-367	CLIP-seq
MIRT2600803	hsa-miR-376c	CLIP-seq
MIRT2600804	hsa-miR-448	CLIP-seq
MIRT2600805	hsa-miR-4633-5p	CLIP-seq
MIRT2600806	hsa-miR-4698	CLIP-seq
MIRT2600807	hsa-miR-4742-3p	CLIP-seq
MIRT2600808	hsa-miR-4759	CLIP-seq
MIRT1262855	hsa-miR-518a-5p	CLIP-seq
MIRT1262858	hsa-miR-527	CLIP-seq
MIRT2600809	hsa-miR-548a-3p	CLIP-seq
MIRT2600810	hsa-miR-548e	CLIP-seq
MIRT2600811	hsa-miR-548f	CLIP-seq
MIRT2600812	hsa-miR-561	CLIP-seq
MIRT2600813	hsa-miR-92a	CLIP-seq
MIRT2600814	hsa-miR-92b	CLIP-seq
MIRT2600815	hsa-miR-934	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0004862	Function	CAMP-dependent protein kinase inhibitor activity	IBA
GO:0004862	Function	CAMP-dependent protein kinase inhibitor activity	IDA	21812984
GO:0004862	Function	CAMP-dependent protein kinase inhibitor activity	IEA
GO:0005515	Function	Protein binding	IPI	17148597, 20007971, 23455922, 24605759, 25477193, 25920809, 26496610, 26871637, 27107012, 28514442, 32296183, 32707033, 33058759, 33961781, 35271311
GO:0005737	Component	Cytoplasm	IDA	21423175
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA	21399614
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA	21423175
GO:0005886	Component	Plasma membrane	IEA
GO:0005952	Component	CAMP-dependent protein kinase complex	IBA
GO:0005952	Component	CAMP-dependent protein kinase complex	IEA
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA
GO:0007612	Process	Learning	IEA
GO:0008603	Function	CAMP-dependent protein kinase regulator activity	IDA	21812984
GO:0008603	Function	CAMP-dependent protein kinase regulator activity	IEA
GO:0008603	Function	CAMP-dependent protein kinase regulator activity	TAS	2851102
GO:0016020	Component	Membrane	IEA
GO:0019901	Function	Protein kinase binding	IEA
GO:0019904	Function	Protein domain specific binding	IEA
GO:0030425	Component	Dendrite	IEA
GO:0030552	Function	CAMP binding	IBA
GO:0030552	Function	CAMP binding	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IDA	21423175
GO:0034236	Function	Protein kinase A catalytic subunit binding	IBA
GO:0034236	Function	Protein kinase A catalytic subunit binding	IEA
GO:0034236	Function	Protein kinase A catalytic subunit binding	IPI	21812984
GO:0035556	Process	Intracellular signal transduction	TAS	2851102
GO:0043025	Component	Neuronal cell body	IEA
GO:0043197	Component	Dendritic spine	IEA
GO:0043197	Component	Dendritic spine	ISS
GO:0043198	Component	Dendritic shaft	IEA
GO:0043198	Component	Dendritic shaft	ISS
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0050804	Process	Modulation of chemical synaptic transmission	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0097332	Process	Response to antipsychotic drug	IEA
GO:0097546	Component	Ciliary base	IEA
GO:0097546	Component	Ciliary base	TAS
GO:0098794	Component	Postsynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0141162	Process	Negative regulation of cAMP/PKA signal transduction	IDA	21812984
GO:0141162	Process	Negative regulation of cAMP/PKA signal transduction	IEA

Other IDs

• MIM: 176912
• HGNC: 9392
• e!Ensembl: ENSG00000005249

Protein

• UniProt ID: P31323
• Protein name: cAMP-dependent protein kinase type II-beta regulatory subunit
• Protein function: Regulatory subunit of the cAMP-dependent protein kinases involved in cAMP signaling in cells. Type II regulatory chains mediate membrane association by binding to anchoring proteins, including the MAP2 kinase.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02197	RIIa	7 → 44	Regulatory subunit of type II PKA R-subunit	Domain
  PF00027	cNMP_binding	172 → 259	Cyclic nucleotide-binding domain	Domain
  PF00027	cNMP_binding	294 → 387	Cyclic nucleotide-binding domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Four types of regulatory chains are found: I-alpha, I-beta, II-alpha, and II-beta. Their expression varies among tissues and is in some cases constitutive and in others inducible.
• Sequence:

  MSIEIPAGLTELLQGFTVEVLRHQPADLLEFALQHFTRLQQENERKGTARFGHEGRTWGD
  LGAAAGGGTPSKGVNFAEEPMQSDSEDGEEEEAAPADAGAFNAPVINRFTRRASVCAEAY
  NPDEEEDDAESRIIHPKTDDQRNRLQEACKDILLFKNLDPEQMSQVLDAMFEKLVKDGEH
  VIDQGDDGDNFYVIDRGTFDIYVKCDGVGRCVGNYDNRGSFGELALMYNTPRAATITATS
  PGALWGLDRVTFRRIIVKNNAKKRKMYESFIESLPFLKSLEFSERLKVVDVIGTKVYNDG
  EQIIAQGDSADSFFIVESGEVKITMKRKGKSEVEENGAVEIARCSRGQYFGELALVTNKP
  RAASAHAIGTVKCLAMDVQAFERLLGPCMEIMKRNIATYEEQLVALFGTNMDIVEPTA

• Sequence length: 418

Pathways

KEGG:

Insulin signaling pathway

Reactome:

PKA activation
PKA activation in glucagon signalling
DARPP-32 events
Regulation of PLK1 Activity at G2/M Transition
Loss of Nlp from mitotic centrosomes
Recruitment of mitotic centrosome proteins and complexes
Loss of proteins required for interphase microtubule organization from the centrosome
Recruitment of NuMA to mitotic centrosomes
Vasopressin regulates renal water homeostasis via Aquaporins
CREB1 phosphorylation through the activation of Adenylate Cyclase
Hedgehog 'off' state
Anchoring of the basal body to the plasma membrane
AURKA Activation by TPX2
ADORA2B mediated anti-inflammatory cytokines production
FCGR3A-mediated IL10 synthesis
Factors involved in megakaryocyte development and platelet production

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenoma	Adenoma	BEFREE	18505904		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	25268545	Associate	★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	18056771	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	26336805	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	25393625	Stimulate	★☆☆☆☆ Found in Text Mining only
Congenital chloride diarrhea	Congenital chloride diarrhea	Pubtator	8963897	Associate	★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	20824711		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	CTD_human_DG	26670611		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Degenerative polyarthritis	Arthritis	BEFREE	22586168		★☆☆☆☆ Found in Text Mining only
FOXG1 syndrome	FOXG1 Syndrome	BEFREE	30539330		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	CTD_human_DG	26670611		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure, Right-Sided	Heart Failure	CTD_human_DG	26670611		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	32888289	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	32111982	Inhibit	★☆☆☆☆ Found in Text Mining only
Left-Sided Heart Failure	Heart Failure	CTD_human_DG	26670611		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	10946316	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	14500661		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	18544528, 37569769	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	28800317, 29761841		★☆☆☆☆ Found in Text Mining only
Myocardial Failure	Myocardial Infarction	CTD_human_DG	26670611		★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	BEFREE	30721303		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	CTD_human_DG	20975297		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	20975297	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	BEFREE	24914943		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteosarcoma	Osteosarcoma	Pubtator	22355351	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	LHGDN	12727985		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	28800317, 29761841		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	22355351, 28800317, 31986411	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	30361509	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	24737441		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	25393625	Associate	★☆☆☆☆ Found in Text Mining only