Gene Gene information from NCBI Gene database.
Entrez ID 5576
Gene name Protein kinase cAMP-dependent type II regulatory subunit alpha
Gene symbol PRKAR2A
Synonyms (NCBI Gene)
PKR2PRKAR2
Chromosome 3
Chromosome location 3p21.31
Summary cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins. The inactive kinase holo
miRNA miRNA information provided by mirtarbase database.
577
miRTarBase ID miRNA Experiments Reference
MIRT004218 hsa-miR-197-3p Microarray 16822819
MIRT020699 hsa-miR-155-5p Proteomics 18668040
MIRT027082 hsa-miR-103a-3p Sequencing 20371350
MIRT031655 hsa-miR-16-5p Sequencing 20371350
MIRT032313 hsa-let-7b-5p Proteomics 18668040
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
42
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0004862 Function CAMP-dependent protein kinase inhibitor activity IBA
GO:0004862 Function CAMP-dependent protein kinase inhibitor activity IDA 21812984
GO:0004862 Function CAMP-dependent protein kinase inhibitor activity IEA
GO:0005515 Function Protein binding IPI 9473338, 11278869, 11414803, 12475942, 16642035, 17911601, 20007971, 22343722, 22976297, 24083380, 24981860, 25920809, 26496610, 27484798, 32296183, 33961781, 35271311
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
176910 9391 ENSG00000114302
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P13861
Protein name cAMP-dependent protein kinase type II-alpha regulatory subunit
Protein function Regulatory subunit of the cAMP-dependent protein kinases involved in cAMP signaling in cells. Type II regulatory chains mediate membrane association by binding to anchoring proteins, including the MAP2 kinase.
PDB 2IZX , 2KYG , 4ZP3 , 5H78 , 5XBY , 8S8O
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02197 RIIa 8 45 Regulatory subunit of type II PKA R-subunit Domain
PF00027 cNMP_binding 157 244 Cyclic nucleotide-binding domain Domain
PF00027 cNMP_binding 279 373 Cyclic nucleotide-binding domain Domain
Tissue specificity TISSUE SPECIFICITY: Four types of regulatory chains are found: I-alpha, I-beta, II-alpha, and II-beta. Their expression varies among tissues and is in some cases constitutive and in others inducible.
Sequence
MSHIQIPPGLTELLQGYTVEVLRQQPPDLVEFAVEYFTRLREARAPASVLPAATPRQSLG
HPPPEPGPDRVADAKGDSESEEDEDLEVPVPSRFNRRVSVCAETYNPDEEEEDTDPRVIH
PKTDEQRCRLQEACKDILLFKNLDQEQLSQVLDAMFERIVKADEHVIDQGDDGDNFYVIE
RGTYDILVTKDNQTRSVGQYDNRGSFGELALMYNTPRAATIVATSEGSLWGLDRVTFRRI
IVKN
NAKKRKMFESFIESVPLLKSLEVSERMKIVDVIGEKIYKDGERIITQGEKADSFYI
IESGEVSILIRSRTKSNKDGGNQEVEIARCHKGQYFGELALVTNKPRAASAYAVGDVKCL
VMDVQAFERLLGP
CMDIMKRNISHYEEQLVKMFGSSVDLGNLGQ
Sequence length 404
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Insulin signaling pathway   PKA activation
PKA activation in glucagon signalling
DARPP-32 events
Vasopressin regulates renal water homeostasis via Aquaporins
CREB1 phosphorylation through the activation of Adenylate Cyclase
Hedgehog 'off' state
ADORA2B mediated anti-inflammatory cytokines production
FCGR3A-mediated IL10 synthesis
Factors involved in megakaryocyte development and platelet production
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
4
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
CONGESTIVE HEART FAILURE Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
GOUT GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
HEART FAILURE Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
NEPHROLITHIASIS GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adrenal cortical hypofunction Adrenal Cortical Hypofunction BEFREE 29846607
★☆☆☆☆
Found in Text Mining only
Anorexia Nervosa Anorexia nervosa Pubtator 39741260 Associate
★☆☆☆☆
Found in Text Mining only
Cardiovascular Diseases Cardiovascular Diseases BEFREE 19577713
★☆☆☆☆
Found in Text Mining only
Cognitive Dysfunction Cognition disorder Pubtator 25720397 Associate
★☆☆☆☆
Found in Text Mining only
Kallmann Syndrome Kallmann Syndrome BEFREE 16537498, 17191030, 29537336
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of pancreas Pancreatic cancer BEFREE 28121357
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of prostate Prostate cancer BEFREE 25485509
★☆☆☆☆
Found in Text Mining only
Neoplasms Neoplasms BEFREE 28121357
★☆☆☆☆
Found in Text Mining only
Ovarian Diseases Ovarian diseases Pubtator 35295989 Stimulate
★☆☆☆☆
Found in Text Mining only
Ovarian Neoplasms Ovarian neoplasm Pubtator 28893231 Associate
★☆☆☆☆
Found in Text Mining only