Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	55756
Gene name	Integrator complex subunit 9
Gene symbol	INTS9
Synonyms (NCBI Gene)	CPSF2LINT9RC74
Chromosome	8
Chromosome location	8p21.1
Summary	This gene encodes a subunit of the Integrator complex. This protein complex binds the C-terminal domain of RNA polymerase II and likely plays a role in small nuclear RNA processing. The encoded protein has similarities to the subunits of the cleavage and

Show/Hide all (44)

miRTarBase ID	miRNA	Experiments
MIRT1068260	hsa-miR-1253	CLIP-seq
MIRT1068261	hsa-miR-219-1-3p	CLIP-seq
MIRT1068262	hsa-miR-3662	CLIP-seq
MIRT1068263	hsa-miR-4293	CLIP-seq
MIRT1068264	hsa-miR-580	CLIP-seq
MIRT2016622	hsa-miR-1294	CLIP-seq
MIRT2016623	hsa-miR-3616-3p	CLIP-seq
MIRT2016624	hsa-miR-4316	CLIP-seq
MIRT2016625	hsa-miR-4436b-3p	CLIP-seq
MIRT2016626	hsa-miR-4676-5p	CLIP-seq
MIRT2016627	hsa-miR-4721	CLIP-seq
MIRT2016628	hsa-miR-575	CLIP-seq
MIRT2552391	hsa-miR-1197	CLIP-seq
MIRT2552392	hsa-miR-198	CLIP-seq
MIRT2552393	hsa-miR-335	CLIP-seq
MIRT2552394	hsa-miR-412	CLIP-seq
MIRT2552395	hsa-miR-4446-5p	CLIP-seq
MIRT2552396	hsa-miR-4646-5p	CLIP-seq
MIRT2552397	hsa-miR-4731-5p	CLIP-seq
MIRT2552398	hsa-miR-4755-5p	CLIP-seq
MIRT2552399	hsa-miR-4757-5p	CLIP-seq
MIRT2552400	hsa-miR-483-3p	CLIP-seq
MIRT2552401	hsa-miR-494	CLIP-seq
MIRT2552402	hsa-miR-512-3p	CLIP-seq
MIRT2552403	hsa-miR-569	CLIP-seq
MIRT2552404	hsa-miR-642a	CLIP-seq
MIRT2552391	hsa-miR-1197	CLIP-seq
MIRT2682858	hsa-miR-125a-3p	CLIP-seq
MIRT2552392	hsa-miR-198	CLIP-seq
MIRT2552393	hsa-miR-335	CLIP-seq
MIRT2682859	hsa-miR-3934	CLIP-seq
MIRT2552394	hsa-miR-412	CLIP-seq
MIRT2682860	hsa-miR-4252	CLIP-seq
MIRT2552395	hsa-miR-4446-5p	CLIP-seq
MIRT2552396	hsa-miR-4646-5p	CLIP-seq
MIRT2552397	hsa-miR-4731-5p	CLIP-seq
MIRT2552398	hsa-miR-4755-5p	CLIP-seq
MIRT2552399	hsa-miR-4757-5p	CLIP-seq
MIRT2552400	hsa-miR-483-3p	CLIP-seq
MIRT2552401	hsa-miR-494	CLIP-seq
MIRT2552402	hsa-miR-512-3p	CLIP-seq
MIRT2552403	hsa-miR-569	CLIP-seq
MIRT2552404	hsa-miR-642a	CLIP-seq
MIRT2682861	hsa-miR-764	CLIP-seq

Show/Hide all (26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16239144, 24981860, 28396433, 32647223, 33548203, 33686175, 33961781, 36180473
GO:0005634	Component	Nucleus	IDA	29471365, 39032489, 39032490
GO:0005634	Component	Nucleus	IDA	23904267
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	32647223
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	29471365
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	39032490
GO:0005829	Component	Cytosol	IEA
GO:0016180	Process	SnRNA processing	IDA	16239144
GO:0016180	Process	SnRNA processing	IEA
GO:0016180	Process	SnRNA processing	NAS	16239144
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	IMP	36641752
GO:0032039	Component	Integrator complex	IBA
GO:0032039	Component	Integrator complex	IDA	16239144, 29471365, 33548203, 36920904, 39032489, 39032490
GO:0032039	Component	Integrator complex	IEA
GO:0032039	Component	Integrator complex	NAS	33548203
GO:0034243	Process	Regulation of transcription elongation by RNA polymerase II	NAS	32697989
GO:0034472	Process	SnRNA 3'-end processing	IBA
GO:0034472	Process	SnRNA 3'-end processing	IDA	22252320
GO:0090101	Process	Negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway	IEA
GO:0090287	Process	Regulation of cellular response to growth factor stimulus	IEA
GO:0160232	Component	INTAC complex	IDA	33243860, 34004147, 34762484, 36869814, 38570683
GO:0160240	Process	RNA polymerase II transcription initiation surveillance	IDA	33243860, 34004147, 38570683

MIM	HGNC	e!Ensembl
611352	25592	ENSG00000104299

Q9NV88

Protein name

Integrator complex subunit 9 (Int9) (Protein related to CPSF subunits of 74 kDa) (RC-74)

Protein function

Component of the integrator complex, a multiprotein complex that terminates RNA polymerase II (Pol II) transcription in the promoter-proximal region of genes (PubMed:25201415, PubMed:33243860, PubMed:33548203, PubMed:38570683). The integrator co

PDB

5V8W , 7BFP , 7BFQ , 7CUN , 7PKS , 7YCX , 8R22 , 8R23 , 8R2D , 8RBX , 8RBZ , 8RC4 , 8UIB , 8YJB

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF16661	Lactamase_B_6	59 → 267	Metallo-beta-lactamase superfamily domain	Domain
PF10996	Beta-Casp	305 → 426	Beta-Casp domain	Domain

Sequence

MKLYCLSGHPTLPCNVLKFKSTTIMLDCGLDMTSTLNFLPLPLVQSPRLSNLPGWSLKDG
NAFLDKELKECSGHVFVDSVPEFCLPETELIDLSTVDVILISNYHCMMALPYITEHTGFT
GTVYATEPTVQIGRLLMEELVNFIERVPKAQSASLWKNKDIQRLLPSPLKDAVEVSTWRR
CYTMQEVNSALSKIQLVGYSQKIELFGAVQVTPLSSGYALGSSNWIIQSHYEKVSYVSGS
SLLTTHPQPMDQASLKNSDVLVLTGLTQIPTANPDGMVGEFCSNLALTVRNGGNVLVPCY
PSGVIYDLLECLYQYIDSAGLSSVPLYFISPVANSSLEFSQIFAEWLCHNKQSKVYLPEP
PFPHAELIQTNKLKHYPSIHGDFSNDFRQPCVVFTGHPSLRFGDVVHFMELWGKSSLNTV
IFTEPDFSYLEALAPYQPLAMKCIYCPIDTRLNFIQVSKLLKEVQPLHVVCPEQYTQPPP
AQSHRMDLMIDCQPPAMSYRRAEVLALPFKRRYEKIEIMPELADSLVPMEIKPGISLATV
SAVLHTKDNKHLLQPPPRPAQPTSGKKRKRVSDDVPDCKVLKPLLSGSIPVEQFVQTLEK
HGFSDIKVEDTAKGHIVLLQEAETLIQIEEDSTHIICDNDEMLRVRLRDLVLKFLQKF

Sequence length

658

Interactions

View interactions

	Reactome
			RNA polymerase II transcribes snRNA genes

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

INTS9 (integrator complex subunit 9)