Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	55733
Gene name	Hedgehog acyltransferase
Gene symbol	HHAT
Synonyms (NCBI Gene)	MART2NNMSSKI1Skn
Chromosome	1
Chromosome location	1q32.2
Summary	`Skinny hedgehog` (SKI1) encodes an enzyme that acts within the secretory pathway to catalyze amino-terminal palmitoylation of `hedgehog` (see MIM 600725).[supplied by OMIM, Jul 2002]

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1340611668	A>G,T	Likely-pathogenic	Intron variant, initiator codon variant, coding sequence variant, missense variant, upstream transcript variant, 5 prime UTR variant, genic upstream transcript variant

181

Show/Hide all (181)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016338	hsa-miR-193b-3p	Microarray	20304954
MIRT023266	hsa-miR-122-5p	Microarray	17612493
MIRT623707	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT623706	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT623705	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT657445	hsa-miR-93-3p	HITS-CLIP	23824327
MIRT657444	hsa-miR-4663	HITS-CLIP	23824327
MIRT657442	hsa-miR-7160-5p	HITS-CLIP	23824327
MIRT657443	hsa-miR-8077	HITS-CLIP	23824327
MIRT623704	hsa-miR-6895-3p	HITS-CLIP	23824327
MIRT623703	hsa-miR-593-3p	HITS-CLIP	23824327
MIRT623702	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT623701	hsa-miR-6818-3p	HITS-CLIP	23824327
MIRT623707	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT623706	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT623705	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT657445	hsa-miR-93-3p	HITS-CLIP	23824327
MIRT637006	hsa-miR-3189-5p	HITS-CLIP	23824327
MIRT657444	hsa-miR-4663	HITS-CLIP	23824327
MIRT657442	hsa-miR-7160-5p	HITS-CLIP	23824327
MIRT657443	hsa-miR-8077	HITS-CLIP	23824327
MIRT623704	hsa-miR-6895-3p	HITS-CLIP	23824327
MIRT623703	hsa-miR-593-3p	HITS-CLIP	23824327
MIRT623702	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT623701	hsa-miR-6818-3p	HITS-CLIP	23824327
MIRT623707	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT623706	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT623705	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT637006	hsa-miR-3189-5p	HITS-CLIP	23824327
MIRT623704	hsa-miR-6895-3p	HITS-CLIP	23824327
MIRT623703	hsa-miR-593-3p	HITS-CLIP	23824327
MIRT623702	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT623701	hsa-miR-6818-3p	HITS-CLIP	23824327
MIRT623707	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT623706	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT623705	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT623704	hsa-miR-6895-3p	HITS-CLIP	23824327
MIRT623703	hsa-miR-593-3p	HITS-CLIP	23824327
MIRT623702	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT623701	hsa-miR-6818-3p	HITS-CLIP	23824327
MIRT623707	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT623706	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT623705	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT623704	hsa-miR-6895-3p	HITS-CLIP	23824327
MIRT623703	hsa-miR-593-3p	HITS-CLIP	23824327
MIRT623702	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT623701	hsa-miR-6818-3p	HITS-CLIP	23824327
MIRT439160	hsa-let-7c-5p	3'LIFE	25074381
MIRT439127	hsa-miR-10b-5p	3'LIFE	25074381
MIRT439160	hsa-let-7c-5p	3'LIFE	25074381
MIRT439127	hsa-miR-10b-5p	3'LIFE	25074381
MIRT623707	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT623706	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT623705	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT657445	hsa-miR-93-3p	HITS-CLIP	23824327
MIRT657444	hsa-miR-4663	HITS-CLIP	23824327
MIRT657442	hsa-miR-7160-5p	HITS-CLIP	23824327
MIRT657443	hsa-miR-8077	HITS-CLIP	23824327
MIRT623704	hsa-miR-6895-3p	HITS-CLIP	23824327
MIRT623703	hsa-miR-593-3p	HITS-CLIP	23824327
MIRT623702	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT623701	hsa-miR-6818-3p	HITS-CLIP	23824327
MIRT623707	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT623706	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT623705	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT657445	hsa-miR-93-3p	HITS-CLIP	23824327
MIRT637006	hsa-miR-3189-5p	HITS-CLIP	23824327
MIRT657444	hsa-miR-4663	HITS-CLIP	23824327
MIRT657442	hsa-miR-7160-5p	HITS-CLIP	23824327
MIRT657443	hsa-miR-8077	HITS-CLIP	23824327
MIRT623704	hsa-miR-6895-3p	HITS-CLIP	23824327
MIRT623703	hsa-miR-593-3p	HITS-CLIP	23824327
MIRT623702	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT623701	hsa-miR-6818-3p	HITS-CLIP	23824327
MIRT623707	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT623706	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT623705	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT637006	hsa-miR-3189-5p	HITS-CLIP	23824327
MIRT623704	hsa-miR-6895-3p	HITS-CLIP	23824327
MIRT623703	hsa-miR-593-3p	HITS-CLIP	23824327
MIRT623702	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT623701	hsa-miR-6818-3p	HITS-CLIP	23824327
MIRT623707	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT623706	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT623705	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT623704	hsa-miR-6895-3p	HITS-CLIP	23824327
MIRT623703	hsa-miR-593-3p	HITS-CLIP	23824327
MIRT623702	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT623701	hsa-miR-6818-3p	HITS-CLIP	23824327
MIRT623707	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT623706	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT623705	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT623704	hsa-miR-6895-3p	HITS-CLIP	23824327
MIRT623703	hsa-miR-593-3p	HITS-CLIP	23824327
MIRT623702	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT623701	hsa-miR-6818-3p	HITS-CLIP	23824327
MIRT1044989	hsa-miR-193a-3p	CLIP-seq
MIRT1044990	hsa-miR-193b	CLIP-seq
MIRT1044991	hsa-miR-3161	CLIP-seq
MIRT1044992	hsa-miR-3176	CLIP-seq
MIRT1044993	hsa-miR-3591-3p	CLIP-seq
MIRT1044994	hsa-miR-3922-3p	CLIP-seq
MIRT1044995	hsa-miR-4257	CLIP-seq
MIRT1044996	hsa-miR-122	CLIP-seq
MIRT1044997	hsa-miR-188-5p	CLIP-seq
MIRT1044998	hsa-miR-3690	CLIP-seq
MIRT1044999	hsa-miR-4254	CLIP-seq
MIRT1045000	hsa-miR-485-5p	CLIP-seq
MIRT1045001	hsa-miR-877	CLIP-seq
MIRT1044996	hsa-miR-122	CLIP-seq
MIRT2009851	hsa-miR-216a	CLIP-seq
MIRT2009852	hsa-miR-2276	CLIP-seq
MIRT2009853	hsa-miR-3152-5p	CLIP-seq
MIRT2009854	hsa-miR-338-3p	CLIP-seq
MIRT2009855	hsa-miR-3612	CLIP-seq
MIRT1044998	hsa-miR-3690	CLIP-seq
MIRT1044999	hsa-miR-4254	CLIP-seq
MIRT2009856	hsa-miR-4312	CLIP-seq
MIRT2009857	hsa-miR-432	CLIP-seq
MIRT2009858	hsa-miR-4330	CLIP-seq
MIRT2009859	hsa-miR-4432	CLIP-seq
MIRT2009860	hsa-miR-4443	CLIP-seq
MIRT2009861	hsa-miR-4762-5p	CLIP-seq
MIRT2009862	hsa-miR-4772-3p	CLIP-seq
MIRT2009863	hsa-miR-4774-3p	CLIP-seq
MIRT2009864	hsa-miR-4799-5p	CLIP-seq
MIRT1045000	hsa-miR-485-5p	CLIP-seq
MIRT2009865	hsa-miR-508-5p	CLIP-seq
MIRT2009866	hsa-miR-650	CLIP-seq
MIRT1045001	hsa-miR-877	CLIP-seq
MIRT2009867	hsa-miR-942	CLIP-seq
MIRT1044996	hsa-miR-122	CLIP-seq
MIRT1044998	hsa-miR-3690	CLIP-seq
MIRT1044999	hsa-miR-4254	CLIP-seq
MIRT1045000	hsa-miR-485-5p	CLIP-seq
MIRT1045001	hsa-miR-877	CLIP-seq
MIRT2451177	hsa-miR-1205	CLIP-seq
MIRT2451178	hsa-miR-1252	CLIP-seq
MIRT2451179	hsa-miR-1265	CLIP-seq
MIRT2451180	hsa-miR-1286	CLIP-seq
MIRT2451181	hsa-miR-217	CLIP-seq
MIRT2451182	hsa-miR-3173-3p	CLIP-seq
MIRT2451183	hsa-miR-4418	CLIP-seq
MIRT2451184	hsa-miR-4469	CLIP-seq
MIRT2451185	hsa-miR-4494	CLIP-seq
MIRT2451186	hsa-miR-4704-3p	CLIP-seq
MIRT2451187	hsa-miR-4722-5p	CLIP-seq
MIRT2451188	hsa-miR-4764-5p	CLIP-seq
MIRT2451189	hsa-miR-499a-5p	CLIP-seq
MIRT2451190	hsa-miR-509-3-5p	CLIP-seq
MIRT2451191	hsa-miR-509-5p	CLIP-seq
MIRT2545838	hsa-miR-1244	CLIP-seq
MIRT2545839	hsa-miR-1273f	CLIP-seq
MIRT2545840	hsa-miR-1323	CLIP-seq
MIRT2545841	hsa-miR-143	CLIP-seq
MIRT2545842	hsa-miR-1976	CLIP-seq
MIRT2545843	hsa-miR-2115	CLIP-seq
MIRT2545844	hsa-miR-2467-5p	CLIP-seq
MIRT2545845	hsa-miR-3149	CLIP-seq
MIRT2545846	hsa-miR-3188	CLIP-seq
MIRT2545847	hsa-miR-3613-5p	CLIP-seq
MIRT2545848	hsa-miR-3670	CLIP-seq
MIRT2545849	hsa-miR-371b-5p	CLIP-seq
MIRT2545850	hsa-miR-3973	CLIP-seq
MIRT2545851	hsa-miR-3975	CLIP-seq
MIRT2545852	hsa-miR-410	CLIP-seq
MIRT2545853	hsa-miR-4279	CLIP-seq
MIRT2545854	hsa-miR-4649-3p	CLIP-seq
MIRT2545855	hsa-miR-4694-3p	CLIP-seq
MIRT2545856	hsa-miR-4708-5p	CLIP-seq
MIRT2545857	hsa-miR-4770	CLIP-seq
MIRT2545858	hsa-miR-4775	CLIP-seq
MIRT1045000	hsa-miR-485-5p	CLIP-seq
MIRT2545859	hsa-miR-486-5p	CLIP-seq
MIRT2545860	hsa-miR-522	CLIP-seq
MIRT2545861	hsa-miR-548o	CLIP-seq
MIRT2545862	hsa-miR-549	CLIP-seq
MIRT2545863	hsa-miR-568	CLIP-seq
MIRT2545864	hsa-miR-593	CLIP-seq
MIRT2545865	hsa-miR-7	CLIP-seq
MIRT2545866	hsa-miR-890	CLIP-seq

Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000166	Function	Nucleotide binding	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005525	Function	GTP binding	IEA
GO:0005783	Component	Endoplasmic reticulum	IBA
GO:0005783	Component	Endoplasmic reticulum	IDA	18534984
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005794	Component	Golgi apparatus	IDA	18534984
GO:0005794	Component	Golgi apparatus	IEA
GO:0007224	Process	Smoothened signaling pathway	IEA
GO:0008374	Function	O-acyltransferase activity	TAS
GO:0016020	Component	Membrane	IEA
GO:0016409	Function	Palmitoyltransferase activity	IBA
GO:0016409	Function	Palmitoyltransferase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016746	Function	Acyltransferase activity	IEA
GO:0018009	Process	N-terminal peptidyl-L-cysteine N-palmitoylation	IMP	18534984, 31875564
GO:0036211	Process	Protein modification process	IBA

MIM	HGNC	e!Ensembl
605743	18270	ENSG00000054392

Q5VTY9

Protein name

Protein-cysteine N-palmitoyltransferase HHAT (EC 2.3.1.-) (Hedgehog acyltransferase) (Melanoma antigen recognized by T-cells 2) (MART-2) (Skinny hedgehog protein 1)

Protein function

Palmitoyl acyltransferase that catalyzes N-terminal palmitoylation of SHH; which is required for SHH signaling (PubMed:18534984, PubMed:24784881, PubMed:31875564). It also catalyzes N-terminal palmitoylation of DHH (PubMed:24784881). Promotes th

PDB

6P64 , 6UJO , 6UJQ , 6UK2 , 6UK4 , 7MHY , 7MHZ , 7Q1U , 7Q6Z , 7URF

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03062	MBOAT	125 → 442	MBOAT, membrane-bound O-acyltransferase family	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. Expressed in fetal ovary and testis, with high levels of expression observed in Sertoli cells (PubMed:24784881). {ECO:0000269|PubMed:11160356, ECO:0000269|PubMed:24784881}.

Sequence

MLPRWELALYLLASLGFHFYSFYEVYKVSREHEEELDQEFELETDTLFGGLKKDATDFEW
SFWMEWGKQWLVWLLLGHMVVSQMATLLARKHRPWILMLYGMWACWCVLGTPGVAMVLLH
TTISFCVAQFRSQLLTWLCSLLLLSTLRLQGVEEVKRRWYKTENEYYLLQFTLTVRCLYY
TSFSLELCWQQLPAASTSYSFPWMLAYVFYYPVLHNGPILSFSEFIKQMQQQEHDSLKAS
LCVLALGLGRLLCWWWLAELMAHLMYMHAIYSSIPLLETVSCWTLGGLALAQVLFFYVKY
LVLFGVPALLMRLDGLTPPALPRCVSTMFSFTGMWRYFDVGLHNFLIRYVYIPVGGSQHG
LLGTLFSTAMTFAFVSYWHGGYDYLWCWAALNWLGVTVENGVRRLVETPCIQDSLARYFS
PQARRRFHAALASCSTSMLILSNLVFLGGNEVGKTYWNRIFIQGWPWVTLSVLGFLYCYS
HVGIAWAQTYATD

Sequence length

493

Interactions

View interactions

	KEGG		Reactome
	Hedgehog signaling pathway		Hedgehog ligand biogenesis HHAT G278V abrogates palmitoylation of Hh-Np

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Chondrodysplasia-pseudohermaphroditism syndrome	Pathogenic	rs1173716957, rs2092784129	RCV001269340 RCV001269341	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (17)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHONDRODYSPLASIA-DIFFERENCE OF SEX DEVELOPMENT SYNDROME	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROINTESTINAL STROMAL TUMORS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HHAT-related disorder	Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPEROPIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LARGE ARTERY STROKE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NERVOUS SYSTEM DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thalidomide response	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (56)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Ankylosing spondylitis	Ankylosing Spondylitis	GWASCAT_DG	23749187		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	24608521		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blepharophimosis	Blepharophimosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	25889650		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	21525338, 25889650	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrodysplasia-disorder of sex development syndrome	Chondrodysplasia-Disorder Of Sex Development Syndrome	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	34382870	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coloboma of the Retina	Retinal coloboma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Abnormalities	Congenital abnormalities	Pubtator	33749989	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	21423737	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Disorder of Sex Development 46 XY	46, xy disorder of sex development	Pubtator	36631813	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Stromal Sarcoma	Endometrial Stromal Sarcoma	BEFREE	22993327		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eye Abnormalities	Eye abnormalities	Pubtator	36303863	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fundus coloboma	Fundus Coloboma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Sarcoma	Gastrointestinal stromal tumor	CTD_human_DG	27793025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	CTD_human_DG	27793025		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	BEFREE	9222345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	9222345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	31465736		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	7874081		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gonadal Dysgenesis	Gonadal dysgenesis	Pubtator	36303863	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperostosis of skull	Hyperostosis Of Skull	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoplasia of iris	Hypoplasia Of Iris	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	23884247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	25405613		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
LATERAL MENINGOCELE SYNDROME	Lateral Meningocele Syndrome	BEFREE	20664929		★★★★★ ★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	10328110, 16474838, 22993327		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma of uterus	Leiomyosarcoma Of Uterus	BEFREE	556976		★★★★★ ★☆☆☆☆ Found in Text Mining only
LIMB-MAMMARY SYNDROME	Limb-Mammary Syndrome	BEFREE	20664929		★★★★★ ★☆☆☆☆ Found in Text Mining only
Macrotia	Macrotia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Male Pseudohermaphroditism	Male Pseudohermaphroditism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25889650		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	24469057		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	31465736		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	11160356, 23884247, 31289481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	Pubtator	36303863	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Micromelia	Micromelia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Miosis disorder	Miosis Disorder	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple congenital anomalies	Multiple Congenital Anomalies	CLINVAR_DG	15075292, 18534984, 23055936, 24784881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	23884247, 24469057, 24608521, 28408481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10434913, 11701761, 12783878, 16467535, 9222345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nivelon Nivelon Mabille syndrome	Chondrodysplasia-pseudohermaphroditism syndrome	ORPHANET_DG	24784881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	21423737	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	24469057		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	24469057, 24608521		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	23142968		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	23142968		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	GWASCAT_DG	23142968		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	GWASDB_DG	23142968		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sex Differentiation Disorders	Sex Differentiation Disorders	BEFREE	24784881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	11160356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Strabismus	Strabismus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	31177096		★★★★★ ★☆☆☆☆ Found in Text Mining only

HHAT (hedgehog acyltransferase)