Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	55729
Gene name	Activating transcription factor 7 interacting protein
Gene symbol	ATF7IP
Synonyms (NCBI Gene)	AMATF-IPATF7IP1MCAFMCAF1p621
Chromosome	12
Chromosome location	12p13.1
Summary	ATF7IP is a multifunctional nuclear protein that associates with heterochromatin. It can act as a transcriptional coactivator or corepressor depending upon its binding partners (summary by Liu et al., 2009 [PubMed 19106100]).[supplied by OMIM, Nov 2010]

317

Show/Hide all (317)

miRTarBase ID	miRNA	Experiments	Reference
MIRT046291	hsa-miR-23b-3p	CLASH	23622248
MIRT044675	hsa-miR-320a	CLASH	23622248
MIRT037643	hsa-miR-744-5p	CLASH	23622248
MIRT036221	hsa-miR-320b	CLASH	23622248
MIRT568427	hsa-miR-548c-3p	HITS-CLIP	19536157
MIRT711688	hsa-miR-548p	HITS-CLIP	19536157
MIRT711687	hsa-miR-21-5p	HITS-CLIP	19536157
MIRT711686	hsa-miR-590-5p	HITS-CLIP	19536157
MIRT711685	hsa-miR-186-3p	HITS-CLIP	19536157
MIRT711684	hsa-miR-3192-5p	HITS-CLIP	19536157
MIRT711683	hsa-miR-6878-5p	HITS-CLIP	19536157
MIRT711682	hsa-miR-6731-5p	HITS-CLIP	19536157
MIRT711681	hsa-miR-8085	HITS-CLIP	19536157
MIRT711680	hsa-miR-5579-3p	HITS-CLIP	19536157
MIRT711679	hsa-miR-33a-5p	HITS-CLIP	19536157
MIRT711678	hsa-miR-33b-5p	HITS-CLIP	19536157
MIRT711677	hsa-miR-30c-1-3p	HITS-CLIP	19536157
MIRT711676	hsa-miR-30c-2-3p	HITS-CLIP	19536157
MIRT711675	hsa-miR-6788-5p	HITS-CLIP	19536157
MIRT568405	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT616018	hsa-miR-8485	HITS-CLIP	23824327
MIRT613304	hsa-miR-1323	HITS-CLIP	23824327
MIRT613303	hsa-miR-548o-3p	HITS-CLIP	23824327
MIRT568405	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT621076	hsa-miR-652-5p	HITS-CLIP	23824327
MIRT616018	hsa-miR-8485	HITS-CLIP	23824327
MIRT568405	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT616018	hsa-miR-8485	HITS-CLIP	23824327
MIRT613304	hsa-miR-1323	HITS-CLIP	23824327
MIRT613303	hsa-miR-548o-3p	HITS-CLIP	23824327
MIRT568405	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT616018	hsa-miR-8485	HITS-CLIP	23824327
MIRT568405	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT616018	hsa-miR-8485	HITS-CLIP	23824327
MIRT613304	hsa-miR-1323	HITS-CLIP	23824327
MIRT613303	hsa-miR-548o-3p	HITS-CLIP	23824327
MIRT632058	hsa-miR-216a-5p	HITS-CLIP	23824327
MIRT632057	hsa-miR-130a-3p	HITS-CLIP	23824327
MIRT632056	hsa-miR-130b-3p	HITS-CLIP	23824327
MIRT632055	hsa-miR-301a-3p	HITS-CLIP	23824327
MIRT632054	hsa-miR-301b-3p	HITS-CLIP	23824327
MIRT632053	hsa-miR-3666	HITS-CLIP	23824327
MIRT632052	hsa-miR-4295	HITS-CLIP	23824327
MIRT632051	hsa-miR-454-3p	HITS-CLIP	23824327
MIRT632050	hsa-miR-652-3p	HITS-CLIP	23824327
MIRT632049	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT632048	hsa-miR-6736-3p	HITS-CLIP	23824327
MIRT632047	hsa-miR-4485-5p	HITS-CLIP	23824327
MIRT632046	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT632045	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT632044	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT632043	hsa-miR-6722-5p	HITS-CLIP	23824327
MIRT568405	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT616018	hsa-miR-8485	HITS-CLIP	23824327
MIRT613304	hsa-miR-1323	HITS-CLIP	23824327
MIRT613303	hsa-miR-548o-3p	HITS-CLIP	23824327
MIRT568405	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT616018	hsa-miR-8485	HITS-CLIP	23824327
MIRT613304	hsa-miR-1323	HITS-CLIP	23824327
MIRT613303	hsa-miR-548o-3p	HITS-CLIP	23824327
MIRT568405	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT616018	hsa-miR-8485	HITS-CLIP	23824327
MIRT613304	hsa-miR-1323	HITS-CLIP	23824327
MIRT613303	hsa-miR-548o-3p	HITS-CLIP	23824327
MIRT568405	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT616018	hsa-miR-8485	HITS-CLIP	23824327
MIRT613304	hsa-miR-1323	HITS-CLIP	23824327
MIRT613303	hsa-miR-548o-3p	HITS-CLIP	23824327
MIRT568405	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT621076	hsa-miR-652-5p	HITS-CLIP	23824327
MIRT616018	hsa-miR-8485	HITS-CLIP	23824327
MIRT613304	hsa-miR-1323	HITS-CLIP	23824327
MIRT613303	hsa-miR-548o-3p	HITS-CLIP	23824327
MIRT568405	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT616018	hsa-miR-8485	HITS-CLIP	23824327
MIRT613304	hsa-miR-1323	HITS-CLIP	23824327
MIRT613303	hsa-miR-548o-3p	HITS-CLIP	23824327
MIRT568405	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT613304	hsa-miR-1323	HITS-CLIP	23824327
MIRT613303	hsa-miR-548o-3p	HITS-CLIP	23824327
MIRT568405	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT613304	hsa-miR-1323	HITS-CLIP	23824327
MIRT613303	hsa-miR-548o-3p	HITS-CLIP	23824327
MIRT568427	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT568426	hsa-miR-144-3p	PAR-CLIP	20371350
MIRT568425	hsa-miR-16-1-3p	PAR-CLIP	20371350
MIRT568424	hsa-miR-4304	PAR-CLIP	20371350
MIRT568423	hsa-miR-198	PAR-CLIP	20371350
MIRT568422	hsa-miR-520a-5p	PAR-CLIP	20371350
MIRT568421	hsa-miR-525-5p	PAR-CLIP	20371350
MIRT568420	hsa-miR-3129-5p	PAR-CLIP	20371350
MIRT568419	hsa-miR-199b-3p	PAR-CLIP	20371350
MIRT568418	hsa-miR-199a-3p	PAR-CLIP	20371350
MIRT568417	hsa-miR-548ac	PAR-CLIP	20371350
MIRT568416	hsa-miR-548bb-3p	PAR-CLIP	20371350
MIRT568415	hsa-miR-548d-3p	PAR-CLIP	20371350
MIRT568414	hsa-miR-548h-3p	PAR-CLIP	20371350
MIRT568413	hsa-miR-548z	PAR-CLIP	20371350
MIRT568412	hsa-miR-548ae-3p	PAR-CLIP	20371350
MIRT568411	hsa-miR-548ah-3p	PAR-CLIP	20371350
MIRT568410	hsa-miR-548aj-3p	PAR-CLIP	20371350
MIRT568409	hsa-miR-548am-3p	PAR-CLIP	20371350
MIRT568408	hsa-miR-548aq-3p	PAR-CLIP	20371350
MIRT568407	hsa-miR-548j-3p	PAR-CLIP	20371350
MIRT568406	hsa-miR-548x-3p	PAR-CLIP	20371350
MIRT568405	hsa-miR-548as-3p	PAR-CLIP	20371350
MIRT568404	hsa-miR-548l	PAR-CLIP	20371350
MIRT568403	hsa-miR-3130-5p	PAR-CLIP	20371350
MIRT568402	hsa-miR-4482-5p	PAR-CLIP	20371350
MIRT568401	hsa-miR-1244	PAR-CLIP	20371350
MIRT568400	hsa-miR-205-3p	PAR-CLIP	20371350
MIRT568399	hsa-miR-3973	PAR-CLIP	20371350
MIRT568398	hsa-miR-520g-3p	PAR-CLIP	20371350
MIRT568397	hsa-miR-520h	PAR-CLIP	20371350
MIRT568396	hsa-miR-3155a	PAR-CLIP	20371350
MIRT568395	hsa-miR-3155b	PAR-CLIP	20371350
MIRT568394	hsa-miR-484	PAR-CLIP	20371350
MIRT568393	hsa-miR-607	PAR-CLIP	20371350
MIRT491012	hsa-miR-25-3p	PAR-CLIP	23592263
MIRT491011	hsa-miR-32-5p	PAR-CLIP	23592263
MIRT491010	hsa-miR-363-3p	PAR-CLIP	23592263
MIRT491009	hsa-miR-367-3p	PAR-CLIP	23592263
MIRT491008	hsa-miR-92a-3p	PAR-CLIP	23592263
MIRT491007	hsa-miR-92b-3p	PAR-CLIP	23592263
MIRT491006	hsa-miR-3145-3p	PAR-CLIP	23592263
MIRT491005	hsa-miR-548aw	PAR-CLIP	23592263
MIRT491004	hsa-miR-518a-5p	PAR-CLIP	23592263
MIRT491003	hsa-miR-527	PAR-CLIP	23592263
MIRT491002	hsa-miR-1303	PAR-CLIP	23592263
MIRT491001	hsa-miR-599	PAR-CLIP	23592263
MIRT568427	hsa-miR-548c-3p	HITS-CLIP	19536157
MIRT711688	hsa-miR-548p	HITS-CLIP	19536157
MIRT711687	hsa-miR-21-5p	HITS-CLIP	19536157
MIRT711686	hsa-miR-590-5p	HITS-CLIP	19536157
MIRT711685	hsa-miR-186-3p	HITS-CLIP	19536157
MIRT711684	hsa-miR-3192-5p	HITS-CLIP	19536157
MIRT711683	hsa-miR-6878-5p	HITS-CLIP	19536157
MIRT711682	hsa-miR-6731-5p	HITS-CLIP	19536157
MIRT711681	hsa-miR-8085	HITS-CLIP	19536157
MIRT711680	hsa-miR-5579-3p	HITS-CLIP	19536157
MIRT711679	hsa-miR-33a-5p	HITS-CLIP	19536157
MIRT711678	hsa-miR-33b-5p	HITS-CLIP	19536157
MIRT711677	hsa-miR-30c-1-3p	HITS-CLIP	19536157
MIRT711676	hsa-miR-30c-2-3p	HITS-CLIP	19536157
MIRT711675	hsa-miR-6788-5p	HITS-CLIP	19536157
MIRT568405	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT616018	hsa-miR-8485	HITS-CLIP	23824327
MIRT613304	hsa-miR-1323	HITS-CLIP	23824327
MIRT613303	hsa-miR-548o-3p	HITS-CLIP	23824327
MIRT568405	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT621076	hsa-miR-652-5p	HITS-CLIP	23824327
MIRT616018	hsa-miR-8485	HITS-CLIP	23824327
MIRT568405	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT616018	hsa-miR-8485	HITS-CLIP	23824327
MIRT613304	hsa-miR-1323	HITS-CLIP	23824327
MIRT613303	hsa-miR-548o-3p	HITS-CLIP	23824327
MIRT568405	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT616018	hsa-miR-8485	HITS-CLIP	23824327
MIRT568405	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT616018	hsa-miR-8485	HITS-CLIP	23824327
MIRT613304	hsa-miR-1323	HITS-CLIP	23824327
MIRT613303	hsa-miR-548o-3p	HITS-CLIP	23824327
MIRT632058	hsa-miR-216a-5p	HITS-CLIP	23824327
MIRT632057	hsa-miR-130a-3p	HITS-CLIP	23824327
MIRT632056	hsa-miR-130b-3p	HITS-CLIP	23824327
MIRT632055	hsa-miR-301a-3p	HITS-CLIP	23824327
MIRT632054	hsa-miR-301b-3p	HITS-CLIP	23824327
MIRT632053	hsa-miR-3666	HITS-CLIP	23824327
MIRT632052	hsa-miR-4295	HITS-CLIP	23824327
MIRT632051	hsa-miR-454-3p	HITS-CLIP	23824327
MIRT632050	hsa-miR-652-3p	HITS-CLIP	23824327
MIRT632049	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT632048	hsa-miR-6736-3p	HITS-CLIP	23824327
MIRT632047	hsa-miR-4485-5p	HITS-CLIP	23824327
MIRT632046	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT632045	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT632044	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT632043	hsa-miR-6722-5p	HITS-CLIP	23824327
MIRT568405	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT616018	hsa-miR-8485	HITS-CLIP	23824327
MIRT613304	hsa-miR-1323	HITS-CLIP	23824327
MIRT613303	hsa-miR-548o-3p	HITS-CLIP	23824327
MIRT568405	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT616018	hsa-miR-8485	HITS-CLIP	23824327
MIRT613304	hsa-miR-1323	HITS-CLIP	23824327
MIRT613303	hsa-miR-548o-3p	HITS-CLIP	23824327
MIRT568405	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT616018	hsa-miR-8485	HITS-CLIP	23824327
MIRT613304	hsa-miR-1323	HITS-CLIP	23824327
MIRT613303	hsa-miR-548o-3p	HITS-CLIP	23824327
MIRT568405	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT616018	hsa-miR-8485	HITS-CLIP	23824327
MIRT613304	hsa-miR-1323	HITS-CLIP	23824327
MIRT613303	hsa-miR-548o-3p	HITS-CLIP	23824327
MIRT568405	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT621076	hsa-miR-652-5p	HITS-CLIP	23824327
MIRT616018	hsa-miR-8485	HITS-CLIP	23824327
MIRT613304	hsa-miR-1323	HITS-CLIP	23824327
MIRT613303	hsa-miR-548o-3p	HITS-CLIP	23824327
MIRT568405	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT616018	hsa-miR-8485	HITS-CLIP	23824327
MIRT613304	hsa-miR-1323	HITS-CLIP	23824327
MIRT613303	hsa-miR-548o-3p	HITS-CLIP	23824327
MIRT568405	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT613304	hsa-miR-1323	HITS-CLIP	23824327
MIRT613303	hsa-miR-548o-3p	HITS-CLIP	23824327
MIRT568405	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT613304	hsa-miR-1323	HITS-CLIP	23824327
MIRT613303	hsa-miR-548o-3p	HITS-CLIP	23824327
MIRT568427	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT568426	hsa-miR-144-3p	PAR-CLIP	20371350
MIRT568425	hsa-miR-16-1-3p	PAR-CLIP	20371350
MIRT568424	hsa-miR-4304	PAR-CLIP	20371350
MIRT568423	hsa-miR-198	PAR-CLIP	20371350
MIRT568422	hsa-miR-520a-5p	PAR-CLIP	20371350
MIRT568421	hsa-miR-525-5p	PAR-CLIP	20371350
MIRT568420	hsa-miR-3129-5p	PAR-CLIP	20371350
MIRT568419	hsa-miR-199b-3p	PAR-CLIP	20371350
MIRT568418	hsa-miR-199a-3p	PAR-CLIP	20371350
MIRT568417	hsa-miR-548ac	PAR-CLIP	20371350
MIRT568416	hsa-miR-548bb-3p	PAR-CLIP	20371350
MIRT568415	hsa-miR-548d-3p	PAR-CLIP	20371350
MIRT568414	hsa-miR-548h-3p	PAR-CLIP	20371350
MIRT568413	hsa-miR-548z	PAR-CLIP	20371350
MIRT568412	hsa-miR-548ae-3p	PAR-CLIP	20371350
MIRT568411	hsa-miR-548ah-3p	PAR-CLIP	20371350
MIRT568410	hsa-miR-548aj-3p	PAR-CLIP	20371350
MIRT568409	hsa-miR-548am-3p	PAR-CLIP	20371350
MIRT568408	hsa-miR-548aq-3p	PAR-CLIP	20371350
MIRT568407	hsa-miR-548j-3p	PAR-CLIP	20371350
MIRT568406	hsa-miR-548x-3p	PAR-CLIP	20371350
MIRT568405	hsa-miR-548as-3p	PAR-CLIP	20371350
MIRT568404	hsa-miR-548l	PAR-CLIP	20371350
MIRT568403	hsa-miR-3130-5p	PAR-CLIP	20371350
MIRT568402	hsa-miR-4482-5p	PAR-CLIP	20371350
MIRT568401	hsa-miR-1244	PAR-CLIP	20371350
MIRT568400	hsa-miR-205-3p	PAR-CLIP	20371350
MIRT568399	hsa-miR-3973	PAR-CLIP	20371350
MIRT568398	hsa-miR-520g-3p	PAR-CLIP	20371350
MIRT568397	hsa-miR-520h	PAR-CLIP	20371350
MIRT568396	hsa-miR-3155a	PAR-CLIP	20371350
MIRT568395	hsa-miR-3155b	PAR-CLIP	20371350
MIRT568394	hsa-miR-484	PAR-CLIP	20371350
MIRT568393	hsa-miR-607	PAR-CLIP	20371350
MIRT491012	hsa-miR-25-3p	PAR-CLIP	23592263
MIRT491011	hsa-miR-32-5p	PAR-CLIP	23592263
MIRT491010	hsa-miR-363-3p	PAR-CLIP	23592263
MIRT491009	hsa-miR-367-3p	PAR-CLIP	23592263
MIRT491008	hsa-miR-92a-3p	PAR-CLIP	23592263
MIRT491007	hsa-miR-92b-3p	PAR-CLIP	23592263
MIRT491006	hsa-miR-3145-3p	PAR-CLIP	23592263
MIRT491005	hsa-miR-548aw	PAR-CLIP	23592263
MIRT491004	hsa-miR-518a-5p	PAR-CLIP	23592263
MIRT491003	hsa-miR-527	PAR-CLIP	23592263
MIRT491002	hsa-miR-1303	PAR-CLIP	23592263
MIRT491001	hsa-miR-599	PAR-CLIP	23592263
MIRT804724	hsa-miR-142-3p	CLIP-seq
MIRT804725	hsa-miR-1587	CLIP-seq
MIRT804726	hsa-miR-1914	CLIP-seq
MIRT804727	hsa-miR-3074-5p	CLIP-seq
MIRT804728	hsa-miR-3124-3p	CLIP-seq
MIRT804729	hsa-miR-340	CLIP-seq
MIRT804730	hsa-miR-3977	CLIP-seq
MIRT804731	hsa-miR-4265	CLIP-seq
MIRT804732	hsa-miR-4280	CLIP-seq
MIRT804733	hsa-miR-4296	CLIP-seq
MIRT804734	hsa-miR-4322	CLIP-seq
MIRT804735	hsa-miR-4417	CLIP-seq
MIRT804736	hsa-miR-4492	CLIP-seq
MIRT804737	hsa-miR-4498	CLIP-seq
MIRT804738	hsa-miR-4656	CLIP-seq
MIRT804739	hsa-miR-4675	CLIP-seq
MIRT804740	hsa-miR-4682	CLIP-seq
MIRT804741	hsa-miR-4741	CLIP-seq
MIRT804742	hsa-miR-501-5p	CLIP-seq
MIRT804743	hsa-miR-762	CLIP-seq
MIRT804744	hsa-miR-935	CLIP-seq
MIRT804724	hsa-miR-142-3p	CLIP-seq
MIRT804729	hsa-miR-340	CLIP-seq
MIRT1937566	hsa-miR-3938	CLIP-seq
MIRT1937567	hsa-miR-3941	CLIP-seq
MIRT804730	hsa-miR-3977	CLIP-seq
MIRT804732	hsa-miR-4280	CLIP-seq
MIRT1937568	hsa-miR-4643	CLIP-seq
MIRT1937569	hsa-miR-466	CLIP-seq
MIRT1937570	hsa-miR-4672	CLIP-seq
MIRT1937571	hsa-miR-4789-3p	CLIP-seq
MIRT1937572	hsa-miR-4789-5p	CLIP-seq
MIRT1937573	hsa-miR-548g	CLIP-seq
MIRT804744	hsa-miR-935	CLIP-seq
MIRT804725	hsa-miR-1587	CLIP-seq
MIRT2177185	hsa-miR-3145-5p	CLIP-seq
MIRT2177186	hsa-miR-3148	CLIP-seq
MIRT2177187	hsa-miR-3591-3p	CLIP-seq
MIRT2177188	hsa-miR-3658	CLIP-seq
MIRT1937566	hsa-miR-3938	CLIP-seq
MIRT1937567	hsa-miR-3941	CLIP-seq
MIRT804731	hsa-miR-4265	CLIP-seq
MIRT804733	hsa-miR-4296	CLIP-seq
MIRT804734	hsa-miR-4322	CLIP-seq
MIRT804735	hsa-miR-4417	CLIP-seq
MIRT2177189	hsa-miR-4422	CLIP-seq
MIRT804736	hsa-miR-4492	CLIP-seq
MIRT804737	hsa-miR-4498	CLIP-seq
MIRT1937568	hsa-miR-4643	CLIP-seq
MIRT804738	hsa-miR-4656	CLIP-seq
MIRT1937569	hsa-miR-466	CLIP-seq
MIRT1937570	hsa-miR-4672	CLIP-seq
MIRT804739	hsa-miR-4675	CLIP-seq
MIRT804740	hsa-miR-4682	CLIP-seq
MIRT804741	hsa-miR-4741	CLIP-seq
MIRT1937571	hsa-miR-4789-3p	CLIP-seq
MIRT2177190	hsa-miR-513a-3p	CLIP-seq
MIRT1937573	hsa-miR-548g	CLIP-seq
MIRT2177191	hsa-miR-548o	CLIP-seq
MIRT2177192	hsa-miR-580	CLIP-seq
MIRT804743	hsa-miR-762	CLIP-seq

Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0003712	Function	Transcription coregulator activity	IBA
GO:0003712	Function	Transcription coregulator activity	IDA	12665582
GO:0003714	Function	Transcription corepressor activity	IEA
GO:0005515	Function	Protein binding	IPI	12665582, 12812986, 26275350, 27732843, 32296183, 33961781, 35271311
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	12665582
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	IMP	27732843
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IBA
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005829	Component	Cytosol	IDA
GO:0006346	Process	DNA methylation-dependent constitutive heterochromatin formation	IMP	27732843
GO:0006355	Process	Regulation of DNA-templated transcription	IBA
GO:0016604	Component	Nuclear body	IDA
GO:0016887	Function	ATP hydrolysis activity	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	12665582
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	12665582

MIM	HGNC	e!Ensembl
613644	20092	ENSG00000171681

Q6VMQ6

Protein name

Activating transcription factor 7-interacting protein 1 (ATF-interacting protein) (ATF-IP) (ATF7-interacting protein) (ATFa-associated modulator) (hAM) (MBD1-containing chromatin-associated factor 1) (P621)

Protein function

Recruiter that couples transcriptional factors to general transcription apparatus and thereby modulates transcription regulation and chromatin formation. Can both act as an activator or a repressor depending on the context. Required for HUSH-med

PDB

2RPQ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF16788	ATF7IP_BD	564 → 779	ATF-interacting protein binding domain	Family
PF16794	fn3_4	1159 → 1260	Fibronectin-III type domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected at low levels in breast, lung and stomach; highly up-regulated in the corresponding cancerous tissues (at protein level). {ECO:0000269|PubMed:19106100}.

Sequence

MDSLEEPQKKVFKARKTMRVSDRQQLEAVYKVKEELLKTDVKLLNGNHENGDLDPTSPLE
NMDYIKDKEEVNGIEEICFDPEGSKAEWKETPCILSVNVKNKQDDDLNCEPLSPHNITPE
PVSKLPAEPVSGDPAPGDLDAGDPASGVLASGDSTSGDPTSSEPSSSDAASGDATSGDAP
SGDVSPGDATSGDATADDLSSGDPTSSDPIPGEPVPVEPISGDCAADDIASSEITSVDLA
SGAPASTDPASDDLASGDLSSSELASDDLATGELASDELTSESTFDRTFEPKSVPVCEPV
PEIDNIEPSSNKDDDFLEKNGADEKLEQIQSKDSLDEKNKADNNIDANEETLETDDTTIC
SDRPPENEKKVEEDIITELALGEDAISSSMEIDQGEKNEDETSADLVETINENVIEDNKS
ENILENTDSMETDEIIPILEKLAPSEDELTCFSKTSLLPIDETNPDLEEKMESSFGSPSK
QESSESLPKEAFLVLSDEEDISGEKDESEVISQNETCSPAEVESNEKDNKPEEEEQVIHE
DDERPSEKNEFSRRKRSKSEDMDNVQSKRRRYMEEEYEAEFQVKITAKGDINQKLQKVIQ
WLLEEKLCALQCAVFDKTLAELKTRVEKIECNKRHKTVLTELQAKIARLTKRFEAAKEDL
KKRHEHPPNPPVSPGKTVNDVNSNNNMSYRNAGTVRQMLESKRNVSESAPPSFQTPVNTV
SSTNLVTPPAVVSSQPKLQTPVTSGSLTATSVLPAPNTATVVATTQVPSGNPQPTISLQP
LPVILHVPVAVSSQPQLLQSHPGTLVTNQPSGNVEFISVQSPPTVSGLTKNPVSLPSLPN
PTKPNNVPSVPSPSIQRNPTASAAPLGTTLAVQAVPTAHSIVQATRTSLPTVGPSGLYSP
STNRGPIQMKIPISAFSTSSAAEQNSNTTPRIENQTNKTIDASVSKKAADSTSQCGKATG
SDSSGVIDLTMDDEESGASQDPKKLNHTPVSTMSSSQPVSRPLQPIQPAPPLQPSGVPTS
GPSQTTIHLLPTAPTTVNVTHRPVTQVTTRLPVPRAPANHQVVYTTLPAPPAQAPLRGTV
MQAPAVRQVNPQNSVTVRVPQTTTYVVNNGLTLGSTGPQLTVHHRPPQVHTEPPRPVHPA
PLPEAPQPQRLPPEAASTSLPQKPHLKLARVQSQNGIVLSWSVLEVDRSCATVDSYHLYA
YHEEPSATVPSQWKKIGEVKALPLPMACTLTQFVSGSKYYFAVRAKDIYGRFGPFCDPQS
TDVISSTQSS

Sequence length

1270

Interactions

View interactions

	Reactome
			PKMTs methylate histone lysines

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (11)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEONECROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TESTICULAR CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TESTICULAR GERM CELL TUMOR	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TESTICULAR NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (95)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	24628626		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	8592656		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	10738680, 10756004, 11244044, 11485622, 11559817, 11846984, 12469209, 12626894, 12706085, 12708749, 1498321, 15310405, 15494269, 16155606, 16595374 View all (48 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	BEFREE	29501990		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	31468286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anhedonia	Anhedonia	BEFREE	27702411		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	35175239	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	18054208, 23586533, 23986266, 28276950, 28357969, 28390063, 28483085, 28535332, 28564628, 28684258, 28992526, 29308937, 29380275, 29558528, 29575009 View all (11 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	18054208, 23586533, 23986266, 28276950, 28357969, 28390063, 28483085, 28535332, 28564628, 28684258, 28992526, 29308937, 29380275, 29558528, 29575009 View all (11 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	26712781, 9491917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	29248821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone Marrow Diseases	BEFREE	16877298, 20951636, 23510700, 28954118, 29558516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	29061142, 29475233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	29061142, 37685980	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	29749262		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	24413735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	30911321		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35175239	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	9155717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	11519484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating Diseases	BEFREE	16595374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depression, Bipolar	Bipolar Disorder	BEFREE	28490031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	15365580, 16343697, 18081710, 19629761, 20014955, 23586533, 24746391, 27794623, 28146000, 28160748, 28276950, 28301802, 28385173, 28432040, 28564628 View all (29 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Derealization	Derealization	BEFREE	29501990		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	22745235, 28774662		★★★★★ ★☆☆☆☆ Found in Text Mining only
Embryonal Neoplasm	Embryonal Neoplasm	CTD_human_DG	20543847		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	36966136	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	9236512		★★★★★ ★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	9236512		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	15846221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Follicular adenoma	Adenoma	BEFREE	31468286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	31468286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	CTD_human_DG	20543847		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid receptor deficiency/resistance	Pubtator	29133777	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	33794925	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	8808219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	26148071	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	30452683, 8808219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	28353360		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	30911321		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10365395, 1849984		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	29061142, 34982829	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10673737, 30275528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	11485622, 11846984, 12469209, 12626894, 12706085, 12708749, 1498321, 15310405, 16155606, 16595374, 17258259, 17897946, 18425496, 1995955, 21079688 View all (20 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	30275528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	23051967, 26712781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	8648917		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	28954118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major depression, single episode	Mental Depression	BEFREE	27012230		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	26010085, 29031182, 30055852, 31040680, 31493645		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	29061142, 29475233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of testis	Malignant Neoplasm Of Testis	CTD_human_DG	20543847		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19106100, 21483764		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Testicular Germ Cell Tumor	Malignant testicular germ cell tumor	BEFREE	20543847		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Testicular Germ Cell Tumor	Malignant testicular germ cell tumor	GWASDB_DG	20543847		★★★★★ ★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	BEFREE	29160338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	15365580, 16343697, 18081710, 19629761, 20014955, 23586533, 24746391, 27794623, 28146000, 28160748, 28276950, 28301802, 28385173, 28432040, 28564628 View all (29 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	1491352		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	23051967, 28261198		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	9236512		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	8041400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	22745383, 8592656		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms, Embryonal and Mixed	Neoplasm	CTD_human_DG	20543847		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms, Germ Cell and Embryonal	Neoplasm	CTD_human_DG	20543847		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	10491011, 11080807, 15136590, 15722539, 16155606, 17442981, 18664281, 21079688, 21106989, 28101786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	31468286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	22825822		★★★★★ ★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	30791342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	CTD_human_DG	24413735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	27519553		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	11519484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Progressive pseudorheumatoid dysplasia	Progressive Pseudorheumatoid Dysplasia	BEFREE	30327498		★★★★★ ★☆☆☆☆ Found in Text Mining only
Recurrent depression	Mental Depression	BEFREE	18081710		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	26712781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	23586533		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	GWASCAT_DG	31374203		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Separation Anxiety Disorder	Separation Anxiety Disorder	BEFREE	18054208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe depression	Mental Depression	BEFREE	28301802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sicca Syndrome	Sjogren`s Syndrome	BEFREE	10459164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinal Cord Diseases	Spinal Cord Diseases	BEFREE	16877298, 20951636, 23510700, 28954118, 29558516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	21551455	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Testicular Germ Cell Tumor	Testicular Germ Cell Tumor	BEFREE	23640991		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Testicular Germ Cell Tumor	Testicular Germ Cell Tumor	GWASDB_DG	23666240		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Testicular Germ Cell Tumor	Testicular Germ Cell Tumor	GWASCAT_DG	28604728, 28604732		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Testicular Neoplasms	Testicular Neoplasms	CTD_human_DG	20543847		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Testicular Neoplasms	Testicular Neoplasms	GWASCAT_DG	20543847, 23666240		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Testicular Neoplasms	Testicular neoplasm	Pubtator	21564132	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	31468286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	BEFREE	31468286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	31468286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	7884202		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tumor of Rete Testis	Tumor of Rete Testis	CTD_human_DG	20543847		★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	29031182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	15846221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	25830656		★★★★★ ★☆☆☆☆ Found in Text Mining only

ATF7IP (activating transcription factor 7 interacting protein)