Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	55715
Gene name	Docking protein 4
Gene symbol	DOK4
Synonyms (NCBI Gene)	IRS-5IRS5
Chromosome	16
Chromosome location	16q21

Show/Hide all (86)

miRTarBase ID	miRNA	Experiments	Reference
MIRT039377	hsa-miR-421	CLASH	23622248
MIRT943115	hsa-miR-1909	CLIP-seq
MIRT943116	hsa-miR-214	CLIP-seq
MIRT943117	hsa-miR-3130-3p	CLIP-seq
MIRT943118	hsa-miR-3173-3p	CLIP-seq
MIRT943119	hsa-miR-342-5p	CLIP-seq
MIRT943120	hsa-miR-3619-5p	CLIP-seq
MIRT943121	hsa-miR-3907	CLIP-seq
MIRT943122	hsa-miR-3929	CLIP-seq
MIRT943123	hsa-miR-4419b	CLIP-seq
MIRT943124	hsa-miR-4478	CLIP-seq
MIRT943125	hsa-miR-4488	CLIP-seq
MIRT943126	hsa-miR-4664-5p	CLIP-seq
MIRT943127	hsa-miR-4697-5p	CLIP-seq
MIRT943128	hsa-miR-4779	CLIP-seq
MIRT943129	hsa-miR-486-3p	CLIP-seq
MIRT943130	hsa-miR-761	CLIP-seq
MIRT943131	hsa-miR-767-5p	CLIP-seq
MIRT1979252	hsa-miR-1470	CLIP-seq
MIRT1979253	hsa-miR-1914	CLIP-seq
MIRT1979254	hsa-miR-298	CLIP-seq
MIRT1979255	hsa-miR-3065-5p	CLIP-seq
MIRT1979256	hsa-miR-3944-5p	CLIP-seq
MIRT1979257	hsa-miR-4645-5p	CLIP-seq
MIRT1979258	hsa-miR-4667-3p	CLIP-seq
MIRT1979259	hsa-miR-4670-3p	CLIP-seq
MIRT1979260	hsa-miR-4673	CLIP-seq
MIRT1979261	hsa-miR-505	CLIP-seq
MIRT1979262	hsa-miR-634	CLIP-seq
MIRT2214407	hsa-let-7a	CLIP-seq
MIRT2214408	hsa-let-7b	CLIP-seq
MIRT2214409	hsa-let-7c	CLIP-seq
MIRT2214410	hsa-let-7d	CLIP-seq
MIRT2214411	hsa-let-7e	CLIP-seq
MIRT2214412	hsa-let-7f	CLIP-seq
MIRT2214413	hsa-let-7g	CLIP-seq
MIRT2214414	hsa-let-7i	CLIP-seq
MIRT2214415	hsa-miR-103a	CLIP-seq
MIRT2214416	hsa-miR-107	CLIP-seq
MIRT2214417	hsa-miR-125a-5p	CLIP-seq
MIRT2214418	hsa-miR-125b	CLIP-seq
MIRT2214419	hsa-miR-1301	CLIP-seq
MIRT1979253	hsa-miR-1914	CLIP-seq
MIRT2214420	hsa-miR-202	CLIP-seq
MIRT943116	hsa-miR-214	CLIP-seq
MIRT2214421	hsa-miR-2467-5p	CLIP-seq
MIRT2214422	hsa-miR-29a	CLIP-seq
MIRT2214423	hsa-miR-29b	CLIP-seq
MIRT2214424	hsa-miR-29c	CLIP-seq
MIRT2214425	hsa-miR-3065-3p	CLIP-seq
MIRT2214426	hsa-miR-3188	CLIP-seq
MIRT2214427	hsa-miR-3614-3p	CLIP-seq
MIRT943120	hsa-miR-3619-5p	CLIP-seq
MIRT2214428	hsa-miR-3667-3p	CLIP-seq
MIRT2214429	hsa-miR-3943	CLIP-seq
MIRT2214430	hsa-miR-3975	CLIP-seq
MIRT2214431	hsa-miR-4270	CLIP-seq
MIRT2214432	hsa-miR-4297	CLIP-seq
MIRT2214433	hsa-miR-4313	CLIP-seq
MIRT2214434	hsa-miR-4319	CLIP-seq
MIRT2214435	hsa-miR-4441	CLIP-seq
MIRT2214436	hsa-miR-4458	CLIP-seq
MIRT2214437	hsa-miR-4500	CLIP-seq
MIRT2214438	hsa-miR-4649-3p	CLIP-seq
MIRT1979258	hsa-miR-4667-3p	CLIP-seq
MIRT2214439	hsa-miR-4691-5p	CLIP-seq
MIRT2214440	hsa-miR-4717-3p	CLIP-seq
MIRT2214441	hsa-miR-485-5p	CLIP-seq
MIRT2214442	hsa-miR-5047	CLIP-seq
MIRT2214443	hsa-miR-544b	CLIP-seq
MIRT943130	hsa-miR-761	CLIP-seq
MIRT943131	hsa-miR-767-5p	CLIP-seq
MIRT2214444	hsa-miR-98	CLIP-seq
MIRT2387079	hsa-miR-1202	CLIP-seq
MIRT2387080	hsa-miR-3194-5p	CLIP-seq
MIRT2387081	hsa-miR-3972	CLIP-seq
MIRT1979255	hsa-miR-3065-5p	CLIP-seq
MIRT2448481	hsa-miR-3613-3p	CLIP-seq
MIRT2448482	hsa-miR-548ac	CLIP-seq
MIRT2448483	hsa-miR-548d-3p	CLIP-seq
MIRT2448484	hsa-miR-548z	CLIP-seq
MIRT1979255	hsa-miR-3065-5p	CLIP-seq
MIRT2448481	hsa-miR-3613-3p	CLIP-seq
MIRT2448482	hsa-miR-548ac	CLIP-seq
MIRT2448483	hsa-miR-548d-3p	CLIP-seq
MIRT2448484	hsa-miR-548z	CLIP-seq

Show/Hide all (7)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	16273093, 23840749, 25814554, 32296183
GO:0005737	Component	Cytoplasm	IBA
GO:0005829	Component	Cytosol	TAS
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IBA
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	IEA

MIM	HGNC	e!Ensembl
608333	19868	ENSG00000125170

Q8TEW6

Protein name

Docking protein 4 (Downstream of tyrosine kinase 4) (Insulin receptor substrate 5) (IRS-5) (IRS5)

Protein function

DOK proteins are enzymatically inert adaptor or scaffolding proteins. They provide a docking platform for the assembly of multimolecular signaling complexes. DOK4 functions in RET-mediated neurite outgrowth and plays a positive role in activatio

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02174	IRS	135 → 232	PTB domain (IRS-1 type)	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. High expression in skeletal muscle, heart, kidney and liver. Weaker expression in spleen, lung and small intestine, brain, heart and. Expressed in both resting and activated peripheral blood T-cells. {ECO:0000269|PubM

Sequence

MATNFSDIVKQGYVKMKSRKLGIYRRCWLVFRKSSSKGPQRLEKYPDEKSVCLRGCPKVT
EISNVKCVTRLPKETKRQAVAIIFTDDSARTFTCDSELEAEEWYKTLSVECLGSRLNDIS
LGEPDLLAPGVQCEQTDRFNVFLLPCPNLDVYGECKLQITHENIYLWDIHNPRVKLVSWP
LCSLRRYGRDATRFTFEAGRMCDAGEGLYTFQTQEGEQIYQRVHSATLAIAEQHKRVLLE
MEKNVRLLNKGTEHYSYPCTPTTMLPRSAYWHHITGSQNIAEASSYAGEGYGAAQASSET
DLLNRFILLKPKPSQGDSSEAKTPSQ

Sequence length

326

Interactions

View interactions

	Reactome
			RET signaling

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Cervical cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOSITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (9)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	21375733	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	19073520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	17443497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	17443497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	21385932	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	19073520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	19073520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	19073520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	21375733		★★★★★ ★☆☆☆☆ Found in Text Mining only

DOK4 (docking protein 4)