Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	55711
Gene name	Fatty acyl-CoA reductase 2
Gene symbol	FAR2
Synonyms (NCBI Gene)	HEL-S-81MLSTD1SDR10E2
Chromosome	12
Chromosome location	12p11.22
Summary	This gene belongs to the short chain dehydrogenase/reductase superfamily. It encodes a reductase enzyme involved in the first step of wax biosynthesis wherein fatty acids are converted to fatty alcohols. The encoded peroxisomal protein utilizes saturated

Show/Hide all (55)

miRTarBase ID	miRNA	Experiments	Reference
MIRT549780	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT549781	hsa-miR-8063	PAR-CLIP	21572407
MIRT549779	hsa-miR-4698	PAR-CLIP	21572407
MIRT525846	hsa-miR-371b-5p	PAR-CLIP	21572407
MIRT525845	hsa-miR-373-5p	PAR-CLIP	21572407
MIRT525844	hsa-miR-616-5p	PAR-CLIP	21572407
MIRT549778	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT549777	hsa-miR-3924	PAR-CLIP	21572407
MIRT549776	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT525848	hsa-miR-6715a-3p	PAR-CLIP	22012620
MIRT525847	hsa-miR-935	PAR-CLIP	22012620
MIRT525846	hsa-miR-371b-5p	PAR-CLIP	22012620
MIRT525845	hsa-miR-373-5p	PAR-CLIP	22012620
MIRT525844	hsa-miR-616-5p	PAR-CLIP	22012620
MIRT525843	hsa-miR-371a-5p	PAR-CLIP	22012620
MIRT525842	hsa-miR-372-5p	PAR-CLIP	22012620
MIRT525841	hsa-miR-4766-5p	PAR-CLIP	22012620
MIRT525840	hsa-miR-6895-3p	PAR-CLIP	22012620
MIRT525839	hsa-miR-593-3p	PAR-CLIP	22012620
MIRT525837	hsa-miR-6715b-3p	PAR-CLIP	22012620
MIRT525838	hsa-miR-6818-3p	PAR-CLIP	22012620
MIRT549780	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT549781	hsa-miR-8063	PAR-CLIP	21572407
MIRT549779	hsa-miR-4698	PAR-CLIP	21572407
MIRT525846	hsa-miR-371b-5p	PAR-CLIP	21572407
MIRT525845	hsa-miR-373-5p	PAR-CLIP	21572407
MIRT525844	hsa-miR-616-5p	PAR-CLIP	21572407
MIRT549778	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT549777	hsa-miR-3924	PAR-CLIP	21572407
MIRT549776	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT525848	hsa-miR-6715a-3p	PAR-CLIP	22012620
MIRT525847	hsa-miR-935	PAR-CLIP	22012620
MIRT525846	hsa-miR-371b-5p	PAR-CLIP	22012620
MIRT525845	hsa-miR-373-5p	PAR-CLIP	22012620
MIRT525844	hsa-miR-616-5p	PAR-CLIP	22012620
MIRT525843	hsa-miR-371a-5p	PAR-CLIP	22012620
MIRT525842	hsa-miR-372-5p	PAR-CLIP	22012620
MIRT525841	hsa-miR-4766-5p	PAR-CLIP	22012620
MIRT525840	hsa-miR-6895-3p	PAR-CLIP	22012620
MIRT525839	hsa-miR-593-3p	PAR-CLIP	22012620
MIRT525837	hsa-miR-6715b-3p	PAR-CLIP	22012620
MIRT525838	hsa-miR-6818-3p	PAR-CLIP	22012620
MIRT1993205	hsa-miR-128	CLIP-seq
MIRT1993206	hsa-miR-27a	CLIP-seq
MIRT1993207	hsa-miR-27b	CLIP-seq
MIRT1993208	hsa-miR-580	CLIP-seq
MIRT2449469	hsa-miR-1258	CLIP-seq
MIRT2449470	hsa-miR-3121-3p	CLIP-seq
MIRT2449471	hsa-miR-3163	CLIP-seq
MIRT2449472	hsa-miR-374c	CLIP-seq
MIRT2449473	hsa-miR-3945	CLIP-seq
MIRT2449474	hsa-miR-4261	CLIP-seq
MIRT2449475	hsa-miR-4496	CLIP-seq
MIRT2449476	hsa-miR-4761-3p	CLIP-seq
MIRT2449477	hsa-miR-655	CLIP-seq

Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005777	Component	Peroxisome	IBA
GO:0005777	Component	Peroxisome	IEA
GO:0005777	Component	Peroxisome	ISS
GO:0005778	Component	Peroxisomal membrane	IDA	24108123
GO:0005778	Component	Peroxisomal membrane	IEA
GO:0005778	Component	Peroxisomal membrane	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0010025	Process	Wax biosynthetic process	IEA
GO:0010025	Process	Wax biosynthetic process	TAS
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016491	Function	Oxidoreductase activity	TAS
GO:0035336	Process	Long-chain fatty-acyl-CoA metabolic process	IBA
GO:0035336	Process	Long-chain fatty-acyl-CoA metabolic process	IDA	15220348
GO:0080019	Function	Alcohol-forming very long-chain fatty acyl-CoA reductase activity	IBA
GO:0080019	Function	Alcohol-forming very long-chain fatty acyl-CoA reductase activity	IDA	15220348
GO:0080019	Function	Alcohol-forming very long-chain fatty acyl-CoA reductase activity	IEA
GO:0102965	Function	Alcohol-forming long-chain fatty acyl-CoA reductase activity	IEA

MIM	HGNC	e!Ensembl
616156	25531	ENSG00000064763

Q96K12

Protein name

Fatty acyl-CoA reductase 2 (FAR2) (EC 1.2.1.84) (Male sterility domain-containing protein 1)

Protein function

Catalyzes the reduction of saturated but not unsaturated C16 or C18 fatty acyl-CoA to fatty alcohols (FAls) (PubMed:15220348). A lower activity can be observed with shorter fatty acyl-CoA substrates (PubMed:15220348). Can produce very long-chain

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07993	NAD_binding_4	15 → 285	Male sterility protein	Family
PF03015	Sterile	356 → 448	Male sterility protein	Family

Sequence

MSTIAAFYGGKSILITGATGFLGKVLMEKLFRTSPDLKVIYILVRPKAGQTLQQRVFQIL
DSKLFEKVKEVCPNVHEKIRAIYADLNQNDFAISKEDMQELLSCTNIIFHCAATVRFDDT
LRHAVQLNVTATRQLLLMASQMPKLEAFIHISTAYSNCNLKHIDEVIYPCPVEPKKIIDS
LEWLDDAIIDEITPKLIRDWPNIYTYTKALGEMVVQQESRNLNIAIIRPSIVGATWQEPF
PGWVDNINGPNGIIIATGKGFLRAIKATPMAVADVIPVDTVVNLMLAVGWYTAVHRPKST
LVYHITSGNMNPCNWHKMGVQVLATFEKIPFERPFRRPNANFTSNSFTSQYWNAVSHRAP
AIIYDCYLRLTGRKPRMTKLMNRLLRTVSMLEYFINRSWEWSTYNTEMLMSELSPEDQRV
FNFDVRQLNWLEYIENYVLGVKKYLLKEDMAGIPKAKQRLKRLRNIHYLFNTALFLIAWR
LLIARSQMARNVWFFIVSFCYKFLSYFRASSTLKV

Sequence length

515

Interactions

View interactions

	KEGG		Reactome
	Peroxisome		Wax biosynthesis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (15)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESSENTIAL TREMOR	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (13)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alopecia	Alopecia	BEFREE	30372477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	29652635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	35462437	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	26459294		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	29652635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	26459294		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	27542345	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	29652635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	32938960	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	22801071	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pseudopelade	Pseudopelade	BEFREE	30372477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scarring alopecia	Alopecia	BEFREE	30372477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tremor	Tremor	Pubtator	34320404	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

FAR2 (fatty acyl-CoA reductase 2)