Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	55692
Gene name	LUC7 like
Gene symbol	LUC7L
Synonyms (NCBI Gene)	LUC7B1Luc7SR+89hLuc7B1
Chromosome	16
Chromosome location	16p13.3
Summary	The LUC7L gene may represent a mammalian heterochromatic gene, encoding a putative RNA-binding protein similar to the yeast Luc7p subunit of the U1 snRNP splicing complex that is normally required for 5-prime splice site selection (Tufarelli et al., 2001

Show/Hide all (59)

miRTarBase ID	miRNA	Experiments	Reference
MIRT028863	hsa-miR-26b-5p	Microarray	19088304
MIRT031469	hsa-miR-16-5p	Proteomics	18668040
MIRT556403	hsa-miR-4695-5p	PAR-CLIP	21572407
MIRT556402	hsa-miR-10b-3p	PAR-CLIP	21572407
MIRT556401	hsa-miR-4768-3p	PAR-CLIP	21572407
MIRT556400	hsa-miR-4459	PAR-CLIP	21572407
MIRT556399	hsa-miR-4433a-3p	PAR-CLIP	21572407
MIRT556398	hsa-miR-3664-3p	PAR-CLIP	21572407
MIRT556396	hsa-miR-1827	PAR-CLIP	21572407
MIRT556397	hsa-miR-103a-3p	PAR-CLIP	21572407
MIRT556395	hsa-miR-107	PAR-CLIP	21572407
MIRT556394	hsa-miR-4711-5p	PAR-CLIP	21572407
MIRT556393	hsa-miR-3612	PAR-CLIP	21572407
MIRT556392	hsa-miR-650	PAR-CLIP	21572407
MIRT556391	hsa-miR-155-3p	PAR-CLIP	21572407
MIRT556390	hsa-miR-3685	PAR-CLIP	21572407
MIRT556403	hsa-miR-4695-5p	PAR-CLIP	21572407
MIRT556402	hsa-miR-10b-3p	PAR-CLIP	21572407
MIRT556401	hsa-miR-4768-3p	PAR-CLIP	21572407
MIRT556400	hsa-miR-4459	PAR-CLIP	21572407
MIRT556399	hsa-miR-4433a-3p	PAR-CLIP	21572407
MIRT556398	hsa-miR-3664-3p	PAR-CLIP	21572407
MIRT556396	hsa-miR-1827	PAR-CLIP	21572407
MIRT556397	hsa-miR-103a-3p	PAR-CLIP	21572407
MIRT556395	hsa-miR-107	PAR-CLIP	21572407
MIRT556394	hsa-miR-4711-5p	PAR-CLIP	21572407
MIRT556393	hsa-miR-3612	PAR-CLIP	21572407
MIRT556392	hsa-miR-650	PAR-CLIP	21572407
MIRT556391	hsa-miR-155-3p	PAR-CLIP	21572407
MIRT556390	hsa-miR-3685	PAR-CLIP	21572407
MIRT1122357	hsa-miR-1972	CLIP-seq
MIRT1122358	hsa-miR-3922-5p	CLIP-seq
MIRT1122359	hsa-miR-4645-5p	CLIP-seq
MIRT1122360	hsa-miR-4673	CLIP-seq
MIRT1122361	hsa-miR-4708-3p	CLIP-seq
MIRT1122362	hsa-miR-4742-5p	CLIP-seq
MIRT1122363	hsa-miR-4755-3p	CLIP-seq
MIRT738726	hsa-miR-499a-5p	CLIP-seq
MIRT1122364	hsa-miR-3065-3p	CLIP-seq
MIRT1122365	hsa-miR-3120-3p	CLIP-seq
MIRT1122366	hsa-miR-361-5p	CLIP-seq
MIRT1122367	hsa-miR-4494	CLIP-seq
MIRT1122368	hsa-miR-4699-3p	CLIP-seq
MIRT738726	hsa-miR-499a-5p	CLIP-seq
MIRT738726	hsa-miR-499a-5p	CLIP-seq
MIRT738726	hsa-miR-499a-5p	CLIP-seq
MIRT738726	hsa-miR-499a-5p	CLIP-seq
MIRT738726	hsa-miR-499a-5p	CLIP-seq
MIRT738726	hsa-miR-499a-5p	CLIP-seq
MIRT738726	hsa-miR-499a-5p	CLIP-seq
MIRT738726	hsa-miR-499a-5p	CLIP-seq
MIRT738726	hsa-miR-499a-5p	CLIP-seq
MIRT2684285	hsa-miR-1225-3p	CLIP-seq
MIRT2684286	hsa-miR-1233	CLIP-seq
MIRT2684287	hsa-miR-3189-5p	CLIP-seq
MIRT2684288	hsa-miR-4286	CLIP-seq
MIRT2684289	hsa-miR-4323	CLIP-seq
MIRT2684290	hsa-miR-4792	CLIP-seq
MIRT738726	hsa-miR-499a-5p	CLIP-seq

Show/Hide all (11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003729	Function	MRNA binding	IBA
GO:0003729	Function	MRNA binding	IEA
GO:0005515	Function	Protein binding	IPI	22365833, 23602568, 32296183, 32707033, 32814053, 33961781
GO:0005685	Component	U1 snRNP	IBA
GO:0005685	Component	U1 snRNP	IEA
GO:0006376	Process	MRNA splice site recognition	IBA
GO:0006376	Process	MRNA splice site recognition	IEA
GO:0042802	Function	Identical protein binding	IPI	22365833
GO:0045843	Process	Negative regulation of striated muscle tissue development	IEA
GO:0050733	Function	RS domain binding	IEA
GO:0071004	Component	U2-type prespliceosome	IBA

MIM	HGNC	e!Ensembl
607782	6723	ENSG00000007392

Q9NQ29

Protein name

Putative RNA-binding protein Luc7-like 1 (Putative SR protein LUC7B1) (SR+89)

Protein function

May bind to RNA via its Arg/Ser-rich domain.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03194	LUC7	5 → 250	LUC7 N_terminus	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:11170747}.

Sequence

MSAQAQMRALLDQLMGTARDGDETRQRVKFTDDRVCKSHLLDCCPHDILAGTRMDLGECT
KIHDLALRADYEIASKERDLFFELDAMDHLESFIAECDRRTELAKKRLAETQEEISAEVS
AKAEKVHELNEEIGKLLAKAEQLGAEGNVDESQKILMEVEKVRAKKKEAEEEYRNSMPAS
SFQQQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHLGFIQIREKLDQLRKTVAEKQEKRN
QDRLRRREEREREERLSRRSGSRTRDRRRSRSRDRRRRRSRSTSRERRKLSRSRSRDRHR
RHRSRSRSHSRGHRRASRDRSAKYKFSRERASREESWESGRSERGPPDWRLESSNGKMAS
RRSEEKEAGEI

Sequence length

371

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONNECTIVE TISSUE DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL HEMOLYTIC ANEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUC7L-related disorder	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (5)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
alpha-Thalassemia	alpha Thalassemia	BEFREE	12730694		★★★★★ ★☆☆☆☆ Found in Text Mining only
alpha^+^ Thalassemia	alpha Thalassemia	BEFREE	12730694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	12730694		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	37143720	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thalassemia	Thalassemia	Pubtator	28381876	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

LUC7L (LUC7 like)