Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	55657
Gene name	Zinc finger protein 692
Gene symbol	ZNF692
Synonyms (NCBI Gene)	AREBPZfp692
Chromosome	1
Chromosome location	1q44

Show/Hide all (20)

miRTarBase ID	miRNA	Experiments
MIRT1535752	hsa-miR-2355-3p	CLIP-seq
MIRT1535753	hsa-miR-4476	CLIP-seq
MIRT1535754	hsa-miR-4646-3p	CLIP-seq
MIRT1535755	hsa-miR-548a-5p	CLIP-seq
MIRT1535756	hsa-miR-548ab	CLIP-seq
MIRT1535757	hsa-miR-548ak	CLIP-seq
MIRT1535758	hsa-miR-548b-5p	CLIP-seq
MIRT1535759	hsa-miR-548c-5p	CLIP-seq
MIRT1535760	hsa-miR-548d-5p	CLIP-seq
MIRT1535761	hsa-miR-548h	CLIP-seq
MIRT1535762	hsa-miR-548i	CLIP-seq
MIRT1535763	hsa-miR-548j	CLIP-seq
MIRT1535764	hsa-miR-548k	CLIP-seq
MIRT1535765	hsa-miR-548l	CLIP-seq
MIRT1535766	hsa-miR-548w	CLIP-seq
MIRT1535767	hsa-miR-548y	CLIP-seq
MIRT1535768	hsa-miR-559	CLIP-seq
MIRT1535769	hsa-miR-651	CLIP-seq
MIRT1535770	hsa-miR-676	CLIP-seq
MIRT1535771	hsa-miR-7	CLIP-seq

Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	17097062
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	17097062
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	17097062
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IBA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IDA
GO:0006111	Process	Regulation of gluconeogenesis	IMP	21910974
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0060255	Process	Regulation of macromolecule metabolic process	IEA
GO:0080090	Process	Regulation of primary metabolic process	IEA

MIM	HGNC	e!Ensembl
617758	26049	ENSG00000171163

Q9BU19

Protein name

Zinc finger protein 692 (AICAR responsive element binding protein)

Protein function

May act as an transcriptional repressor for PCK1 gene expression, in turn may participate in the hepatic gluconeogenesis regulation through the activated AMPK signaling pathway.

PDB

2D9H , 2DLK , 6H0G

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00096	zf-C2H2	359 → 383	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	389 → 411	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	417 → 439	Zinc finger, C2H2 type	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous (PubMed:17097062). Highly expressed in brain, thymus and spleen (PubMed:17097062). {ECO:0000269|PubMed:17097062}.

Sequence

MASSPAVDVSCRRREKRRQLDARRSKCRIRLGGHMEQWCLLKERLGFSLHSQLAKFLLDR
YTSSGCVLCAGPEPLPPKGLQYLVLLSHAHSRECSLVPGLRGPGGQDGGLVWECSAGHTF
SWGPSLSPTPSEAPKPASLPHTTRRSWCSEATSGQELADLESEHDERTQEARLPRRVGPP
PETFPPPGEEEGEEEEDNDEDEEEMLSDASLWTYSSSPDDSEPDAPRLLPSPVTCTPKEG
ETPPAPAALSSPLAVPALSASSLSSRAPPPAEVRVQPQLSRTPQAAQQTEALASTGSQAQ
SAPTPAWDEDTAQIGPKRIRKAAKRELMPCDFPGCGRIFSNRQYLNHHKKYQHIHQKSFS
CPEPACGKSFNFKKHLKEHMKLHSDTRDYICEFCARSFRTSSNLVIHRRIHTGEKPLQCE
ICGFTCRQKASLNWHQRKHAETVAALRFPCEFCGKRFEKPDSVAAHRSKSHPALLLAPQE
SPSGPLEPCPSISAPGPLGSSEGSRPSASPQAPTLLPQQ

Sequence length

519

Interactions

View interactions

	Reactome
			Generic Transcription Pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
High myopia	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEVERE MYOPIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (12)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	30816443		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	28669730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	37980166	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	30466806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	30466806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	30816443		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ectodermal Dysplasia	Ectodermal dysplasia	Pubtator	37980166	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	37980166	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	30466806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30816443		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	38291502	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	37980166	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

ZNF692 (zinc finger protein 692)