Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	55651
Gene name	NHP2 ribonucleoprotein
Gene symbol	NHP2
Synonyms (NCBI Gene)	DKCB2NHP2PNOLA2
Chromosome	5
Chromosome location	5q35.3
Summary	This gene is a member of the H/ACA snoRNPs (small nucleolar ribonucleoproteins) gene family. snoRNPs are involved in various aspects of rRNA processing and modification and have been classified into two families: C/D and H/ACA. The H/ACA snoRNPs also incl

109

Show/Hide all (109)

miRTarBase ID	miRNA	Experiments	Reference
MIRT050265	hsa-miR-25-3p	CLASH	23622248
MIRT042952	hsa-miR-324-3p	CLASH	23622248
MIRT038252	hsa-miR-330-5p	CLASH	23622248
MIRT440114	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440114	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT1184640	hsa-miR-1179	CLIP-seq
MIRT1184641	hsa-miR-1254	CLIP-seq
MIRT1184642	hsa-miR-183	CLIP-seq
MIRT1184643	hsa-miR-205	CLIP-seq
MIRT1184644	hsa-miR-22	CLIP-seq
MIRT1184645	hsa-miR-3116	CLIP-seq
MIRT1184646	hsa-miR-3134	CLIP-seq
MIRT1184647	hsa-miR-433	CLIP-seq
MIRT1184648	hsa-miR-4446-3p	CLIP-seq
MIRT1184649	hsa-miR-4520a-3p	CLIP-seq
MIRT1184650	hsa-miR-4534	CLIP-seq
MIRT1184651	hsa-miR-4675	CLIP-seq
MIRT1184652	hsa-miR-4687-3p	CLIP-seq
MIRT1184653	hsa-miR-4724-3p	CLIP-seq
MIRT1184654	hsa-miR-4741	CLIP-seq
MIRT1184655	hsa-miR-488	CLIP-seq
MIRT1184656	hsa-miR-558	CLIP-seq
MIRT1184657	hsa-miR-661	CLIP-seq
MIRT1184658	hsa-miR-139-5p	CLIP-seq
MIRT1184642	hsa-miR-183	CLIP-seq
MIRT1184646	hsa-miR-3134	CLIP-seq
MIRT1184659	hsa-miR-3168	CLIP-seq
MIRT1184649	hsa-miR-4520a-3p	CLIP-seq
MIRT1184650	hsa-miR-4534	CLIP-seq
MIRT1184660	hsa-miR-4700-3p	CLIP-seq
MIRT1184640	hsa-miR-1179	CLIP-seq
MIRT1184641	hsa-miR-1254	CLIP-seq
MIRT2053544	hsa-miR-1293	CLIP-seq
MIRT1184658	hsa-miR-139-5p	CLIP-seq
MIRT1184642	hsa-miR-183	CLIP-seq
MIRT1184643	hsa-miR-205	CLIP-seq
MIRT2053545	hsa-miR-2110	CLIP-seq
MIRT2053546	hsa-miR-2115	CLIP-seq
MIRT1184644	hsa-miR-22	CLIP-seq
MIRT1184645	hsa-miR-3116	CLIP-seq
MIRT1184646	hsa-miR-3134	CLIP-seq
MIRT2053547	hsa-miR-3150a-3p	CLIP-seq
MIRT1184659	hsa-miR-3168	CLIP-seq
MIRT2053548	hsa-miR-3185	CLIP-seq
MIRT2053549	hsa-miR-3189-3p	CLIP-seq
MIRT2053550	hsa-miR-4271	CLIP-seq
MIRT2053551	hsa-miR-4302	CLIP-seq
MIRT2053552	hsa-miR-4312	CLIP-seq
MIRT2053553	hsa-miR-432	CLIP-seq
MIRT1184647	hsa-miR-433	CLIP-seq
MIRT1184648	hsa-miR-4446-3p	CLIP-seq
MIRT2053554	hsa-miR-4459	CLIP-seq
MIRT2053555	hsa-miR-4471	CLIP-seq
MIRT2053556	hsa-miR-4483	CLIP-seq
MIRT1184649	hsa-miR-4520a-3p	CLIP-seq
MIRT1184650	hsa-miR-4534	CLIP-seq
MIRT2053557	hsa-miR-4646-5p	CLIP-seq
MIRT1184651	hsa-miR-4675	CLIP-seq
MIRT2053558	hsa-miR-4676-5p	CLIP-seq
MIRT1184652	hsa-miR-4687-3p	CLIP-seq
MIRT2053559	hsa-miR-4697-3p	CLIP-seq
MIRT1184660	hsa-miR-4700-3p	CLIP-seq
MIRT2053560	hsa-miR-4722-5p	CLIP-seq
MIRT1184653	hsa-miR-4724-3p	CLIP-seq
MIRT2053561	hsa-miR-4725-3p	CLIP-seq
MIRT1184654	hsa-miR-4741	CLIP-seq
MIRT2053562	hsa-miR-4747-5p	CLIP-seq
MIRT1184655	hsa-miR-488	CLIP-seq
MIRT2053563	hsa-miR-541	CLIP-seq
MIRT1184656	hsa-miR-558	CLIP-seq
MIRT2053564	hsa-miR-575	CLIP-seq
MIRT2053565	hsa-miR-654-5p	CLIP-seq
MIRT1184657	hsa-miR-661	CLIP-seq
MIRT1184640	hsa-miR-1179	CLIP-seq
MIRT1184644	hsa-miR-22	CLIP-seq
MIRT2053557	hsa-miR-4646-5p	CLIP-seq
MIRT1184656	hsa-miR-558	CLIP-seq
MIRT1184640	hsa-miR-1179	CLIP-seq
MIRT1184641	hsa-miR-1254	CLIP-seq
MIRT2053544	hsa-miR-1293	CLIP-seq
MIRT2053545	hsa-miR-2110	CLIP-seq
MIRT1184644	hsa-miR-22	CLIP-seq
MIRT1184645	hsa-miR-3116	CLIP-seq
MIRT2053547	hsa-miR-3150a-3p	CLIP-seq
MIRT2053548	hsa-miR-3185	CLIP-seq
MIRT2053549	hsa-miR-3189-3p	CLIP-seq
MIRT2053550	hsa-miR-4271	CLIP-seq
MIRT2053551	hsa-miR-4302	CLIP-seq
MIRT2053552	hsa-miR-4312	CLIP-seq
MIRT1184648	hsa-miR-4446-3p	CLIP-seq
MIRT2053554	hsa-miR-4459	CLIP-seq
MIRT2053555	hsa-miR-4471	CLIP-seq
MIRT2053556	hsa-miR-4483	CLIP-seq
MIRT2053557	hsa-miR-4646-5p	CLIP-seq
MIRT1184651	hsa-miR-4675	CLIP-seq
MIRT2053558	hsa-miR-4676-5p	CLIP-seq
MIRT1184652	hsa-miR-4687-3p	CLIP-seq
MIRT2053559	hsa-miR-4697-3p	CLIP-seq
MIRT2053560	hsa-miR-4722-5p	CLIP-seq
MIRT2053561	hsa-miR-4725-3p	CLIP-seq
MIRT1184654	hsa-miR-4741	CLIP-seq
MIRT2053562	hsa-miR-4747-5p	CLIP-seq
MIRT1184655	hsa-miR-488	CLIP-seq
MIRT2053563	hsa-miR-541	CLIP-seq
MIRT1184656	hsa-miR-558	CLIP-seq
MIRT2053564	hsa-miR-575	CLIP-seq
MIRT2053565	hsa-miR-654-5p	CLIP-seq
MIRT1184657	hsa-miR-661	CLIP-seq
MIRT2053557	hsa-miR-4646-5p	CLIP-seq

Show/Hide all (36)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000454	Process	SnoRNA guided rRNA pseudouridine synthesis	IEA
GO:0000781	Component	Chromosome, telomeric region	HDA	19135898
GO:0003723	Function	RNA binding	HDA	22658674
GO:0003723	Function	RNA binding	IEA
GO:0003723	Function	RNA binding	IPI	18082603, 20351177, 22527283
GO:0003730	Function	MRNA 3'-UTR binding	IEA
GO:0005515	Function	Protein binding	IPI	23685356, 25416956, 25910212, 30021884, 31515488, 32296183, 32814053, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005697	Component	Telomerase holoenzyme complex	IDA	18082603, 29695869
GO:0005697	Component	Telomerase holoenzyme complex	NAS	20351177
GO:0005697	Component	Telomerase holoenzyme complex	TAS	20351177, 22527283
GO:0005730	Component	Nucleolus	IEA
GO:0005732	Component	Sno(s)RNA-containing ribonucleoprotein complex	ISS
GO:0006364	Process	RRNA processing	IEA
GO:0007004	Process	Telomere maintenance via telomerase	IDA	29695869
GO:0007004	Process	Telomere maintenance via telomerase	NAS	20351177
GO:0007004	Process	Telomere maintenance via telomerase	TAS	22527283
GO:0015030	Component	Cajal body	IEA
GO:0031118	Process	RRNA pseudouridine synthesis	IBA
GO:0031118	Process	RRNA pseudouridine synthesis	ISS
GO:0031120	Process	SnRNA pseudouridine synthesis	IBA
GO:0031429	Component	Box H/ACA snoRNP complex	IBA
GO:0031429	Component	Box H/ACA snoRNP complex	IDA	18082603
GO:0031429	Component	Box H/ACA snoRNP complex	IEA
GO:0031429	Component	Box H/ACA snoRNP complex	TAS	22527283
GO:0034511	Function	U3 snoRNA binding	IEA
GO:0034513	Function	Box H/ACA snoRNA binding	IBA
GO:0034513	Function	Box H/ACA snoRNA binding	IPI	18082603
GO:0042254	Process	Ribosome biogenesis	IEA
GO:0070034	Function	Telomerase RNA binding	IPI	18082603, 20351177, 22527283
GO:0072589	Component	Box H/ACA scaRNP complex	TAS	22527283
GO:0090661	Component	Box H/ACA telomerase RNP complex	IDA	18082603
GO:0090661	Component	Box H/ACA telomerase RNP complex	TAS	22527283
GO:0090671	Process	Telomerase RNA localization to Cajal body	HMP	25467444
GO:1990904	Component	Ribonucleoprotein complex	IEA

MIM	HGNC	e!Ensembl
606470	14377	ENSG00000145912

Q9NX24

Protein name

H/ACA ribonucleoprotein complex subunit 2 (Nucleolar protein family A member 2) (snoRNP protein NHP2)

Protein function

Required for ribosome biogenesis and telomere maintenance. Part of the H/ACA small nucleolar ribonucleoprotein (H/ACA snoRNP) complex, which catalyzes pseudouridylation of rRNA. This involves the isomerization of uridine such that the ribose is

PDB

7BGB , 7TRC , 7V9A , 8OUE , 8OUF

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01248	Ribosomal_L7Ae	45 → 139	Ribosomal protein L7Ae/L30e/S12e/Gadd45 family	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in brain, colon, heart, kidney, ovary, pancreas, placenta, prostate, skeletal muscle, small intestine, spleen, testis and thymus. Also expressed at lower levels in the liver. {ECO:0000269|PubMed:12020816}.

Sequence

MTKIKADPDGPEAQAEACSGERTYQELLVNQNPIAQPLASRRLTRKLYKCIKKAVKQKQI
RRGVKEVQKFVNKGEKGIMVLAGDTLPIEVYCHLPVMCEDRNLPYVYIPSKTDLGAAAGS
KRPTCVIMVKPHEEYQEAYDECLEEVQSLPLPL

Sequence length

153

Interactions

View interactions

	KEGG		Reactome
	Ribosome biogenesis in eukaryotes		Telomere Extension By Telomerase rRNA modification in the nucleus and cytosol

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Dyskeratosis congenita, autosomal recessive 1	Pathogenic	rs121908089, rs121908090, rs121908091	RCV000032277 RCV000032276 RCV000032278	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Dyskeratosis congenita, autosomal recessive 2	Pathogenic	rs121908089, rs121908090, rs121908091	RCV000004501 RCV000004502 RCV000004503	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (12)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Dyskeratosis congenita	Uncertain significance; Likely benign; Benign; Conflicting classifications of pathogenicity	ClinVar Disgenet, Orphanet Disgenet, Orphanet Disgenet, Orphanet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
DYSKERATOSIS CONGENITA, AUTOSOMAL RECESSIVE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dyskeratosis Congenita, Recessive	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial pancreatic carcinoma	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NHP2-related disorder	Likely benign; Benign; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (58)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alopecia	Alopecia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrophy of testis	Testicular atrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Marrow Failure Disorders	Bone marrow failure syndromes	Pubtator	37440454	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34129943	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depression Postpartum	Major depressive disorder	Pubtator	34856750	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyskeratosis Congenita	Dyskeratosis Congenita	GENOMICS_ENGLAND_DG	11160879, 20008900, 22965356, 28297620		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Dyskeratosis Congenita	Dyskeratosis Congenita	BEFREE	18523010, 20008900, 30472699		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Dyskeratosis Congenita	Dyskeratosis congenita	Pubtator	18523010, 19036115, 30728146	Associate	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Dyskeratosis congenita	Dyskeratosis Congenita	Orphanet			★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Dyskeratosis Congenita	Dyskeratosis Congenita	CLINVAR_DG			★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Dyskeratosis Congenita Autosomal Recessive	Dyskeratosis congenita	Pubtator	18523010	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyskeratosis Congenita, Autosomal Recessive	Dyskeratosis Congenita	BEFREE	18523010		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dyskeratosis Congenita, Autosomal Recessive	Dyskeratosis Congenita	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSKERATOSIS CONGENITA, AUTOSOMAL RECESSIVE 2	Dyskeratosis Congenita	CLINGEN_DG	11160879, 18523010, 20008900, 25467444		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
DYSKERATOSIS CONGENITA, AUTOSOMAL RECESSIVE 2	Dyskeratosis Congenita	GENOMICS_ENGLAND_DG	11160879, 18523010, 20008900		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
DYSKERATOSIS CONGENITA, AUTOSOMAL RECESSIVE 2	Dyskeratosis Congenita	UNIPROT_DG	18523010		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
DYSKERATOSIS CONGENITA, AUTOSOMAL RECESSIVE 2	Dyskeratosis Congenita	CTD_human_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
DYSKERATOSIS CONGENITA, AUTOSOMAL RECESSIVE 2	Dyskeratosis Congenita	CLINVAR_DG			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Dystrophia unguium	Nail dystrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	35054812	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Stenosis	Esophageal Stenosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Stricture	Esophageal Stricture	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Excessive tearing	Excessive Tearing	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
HOYERAAL-HREIDARSSON SYNDROME	Hoyeraal-Hreidarsson Syndrome	GENOMICS_ENGLAND_DG	20008900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypodontia	Hypodontia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoplasia of the maxilla	Hypoplasia of the maxilla	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoderma, Palmoplantar	Palmoplantar keratoderma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	30074154		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukoplakia, Oral	Leukoplakia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	15889794		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malabsorption Syndrome	Malabsorption Syndrome	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Microdontia (disorder)	Microdontia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	37440454	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
NAIL DISORDER, NONSYNDROMIC CONGENITAL, 9	Nail Diseases	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Nail dysplasia	Nail dysplasia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Premature aging syndrome	Premature aging	BEFREE	18523010		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pterygium	Pterygium	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	37440454	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Taurodontism	Taurodontism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Telomeric 22q13 Monosomy Syndrome	22q13 monosomy syndrome	Pubtator	37440454	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

NHP2 (NHP2 ribonucleoprotein)