LYAR (Ly1 antibody reactive)

Gene

• Entrez ID: 55646
• Gene name: Ly1 antibody reactive
• Gene symbol: LYAR
• Synonyms (NCBI Gene): ZC2HC2, ZLYAR
• Chromosome: 4
• Chromosome location: 4p16.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT031947	hsa-miR-16-5p	Proteomics	18668040
MIRT1123070	hsa-miR-3185	CLIP-seq
MIRT1123071	hsa-miR-4519	CLIP-seq
MIRT1123072	hsa-miR-488	CLIP-seq
MIRT1123073	hsa-miR-340	CLIP-seq
MIRT1123074	hsa-miR-3941	CLIP-seq
MIRT1123075	hsa-miR-4643	CLIP-seq
MIRT1123076	hsa-miR-466	CLIP-seq
MIRT1123077	hsa-miR-4672	CLIP-seq
MIRT1123078	hsa-miR-4760-3p	CLIP-seq
MIRT1123079	hsa-miR-4789-3p	CLIP-seq
MIRT1123080	hsa-miR-664	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	31413131
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	25092918
GO:0001750	Component	Photoreceptor outer segment	IEA
GO:0001750	Component	Photoreceptor outer segment	ISS
GO:0002376	Process	Immune system process	IEA
GO:0003677	Function	DNA binding	IBA
GO:0003677	Function	DNA binding	IDA	25092918
GO:0003677	Function	DNA binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0005515	Function	Protein binding	IPI	21516116, 22720776, 25092918, 25416956, 30177828, 31515488, 32296183, 33961781, 34029587, 34578187, 36217029
GO:0005634	Component	Nucleus	IDA	22720776, 25092918
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IBA
GO:0005730	Component	Nucleolus	IDA	24495227, 31413131, 31504794
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0006364	Process	RRNA processing	IBA
GO:0006364	Process	RRNA processing	IEA
GO:0006364	Process	RRNA processing	IMP	24495227
GO:0008270	Function	Zinc ion binding	IEA
GO:0042802	Function	Identical protein binding	IPI	32296183
GO:0042995	Component	Cell projection	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0045824	Process	Negative regulation of innate immune response	IDA	31413131
GO:0045943	Process	Positive regulation of transcription by RNA polymerase I	IDA	31504794
GO:0046872	Function	Metal ion binding	IEA
GO:0048821	Process	Erythrocyte development	IMP	25092918
GO:0050766	Process	Positive regulation of phagocytosis	IEA
GO:0050766	Process	Positive regulation of phagocytosis	ISS
GO:0140297	Function	DNA-binding transcription factor binding	IPI	31413131
GO:0140416	Function	Transcription regulator inhibitor activity	IDA	31413131

Other IDs

• MIM: 617684
• HGNC: 26021
• e!Ensembl: ENSG00000145220

Protein

• UniProt ID: Q9NX58
• Protein name: Cell growth-regulating nucleolar protein
• Protein function: Plays a role in the maintenance of the appropriate processing of 47S/45S pre-rRNA to 32S/30S pre-rRNAs and their subsequent processing to produce 18S and 28S rRNAs (PubMed:24495227). Also acts at the level of transcription regulation. Along with
• PDB: 6ZMI, 6ZMO, 6ZVH
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF17848	zf-ACC	3 → 28	Acetyl-coA carboxylase zinc finger domain	Domain
  PF08790	zf-LYAR	31 → 58	LYAR-type C2HC zinc finger	Domain

• Tissue specificity: TISSUE SPECIFICITY: Predominantly expressed in testis. {ECO:0000269|PubMed:24990247}.
• Sequence:

  MVFFTCNACGESVKKIQVEKHVSVCRNCECLSCIDCGKDFWGDDYKNHVKCISEDQKYGG
  KGYEGKTHKGDIKQQAWIQKISELIKRPNVSPKVRELLEQISAFDNVPRKKAKFQNWMKN
  SLKVHNESILDQVWNIFSEASNSEPVNKEQDQRPLHPVANPHAEISTKVPASKVKDAVEQ
  QGEVKKNKRERKEERQKKRKREKKELKLENHQENSRNQKPKKRKKGQEADLEAGGEEVPE
  ANGSAGKRSKKKKQRKDSASEEEAHVGAGKRKRRHSEVETDSKKKKMKLPEHPEGGEPED
  DEAPAKGKFNWKGTIKAILKQAPDNEITIKKLRKKVLAQYYTVTDEHHRSEEELLVIFNK
  KISKNPTFKLLKDKVKLVK

• Sequence length: 379

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CENTRAL NERVOUS SYSTEM ORIGIN VERTIGO	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL VERTIGO	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VESTIBULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adult Medulloblastoma	Medulloblastoma	BEFREE	22815056		★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	36614221	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	28686580, 31504794	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34696677	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	33111744	Associate	★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	22815056		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26413750, 37604903	Associate	★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	22815056		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	28686580		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	28686580	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	24961659	Associate	★☆☆☆☆ Found in Text Mining only