Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	55626
Gene name	Autophagy and beclin 1 regulator 1
Gene symbol	AMBRA1
Synonyms (NCBI Gene)	DCAF3WDR94
Chromosome	11
Chromosome location	11p11.2

308

Show/Hide all (308)

miRTarBase ID	miRNA	Experiments	Reference
MIRT045188	hsa-miR-186-5p	CLASH	23622248
MIRT043533	hsa-miR-331-3p	CLASH	23622248
MIRT042802	hsa-miR-339-5p	CLASH	23622248
MIRT756017	hsa-miR-3653-5p	Luciferase reporter assayWestern blottingqRT-PCR	37464439
MIRT756303	hsa-miR-7-5p	Luciferase reporter assayWestern blottingqRT-PCR	38393538
MIRT779536	hsa-miR-1207-3p	CLIP-seq
MIRT779537	hsa-miR-1236	CLIP-seq
MIRT779538	hsa-miR-1253	CLIP-seq
MIRT779539	hsa-miR-1289	CLIP-seq
MIRT779540	hsa-miR-1294	CLIP-seq
MIRT779541	hsa-miR-1538	CLIP-seq
MIRT779542	hsa-miR-1587	CLIP-seq
MIRT779543	hsa-miR-200b	CLIP-seq
MIRT779544	hsa-miR-200c	CLIP-seq
MIRT779545	hsa-miR-2355-5p	CLIP-seq
MIRT779546	hsa-miR-23a	CLIP-seq
MIRT779547	hsa-miR-23b	CLIP-seq
MIRT779548	hsa-miR-23c	CLIP-seq
MIRT779549	hsa-miR-24	CLIP-seq
MIRT779550	hsa-miR-3127-3p	CLIP-seq
MIRT779551	hsa-miR-3135	CLIP-seq
MIRT779552	hsa-miR-3138	CLIP-seq
MIRT779553	hsa-miR-3165	CLIP-seq
MIRT779554	hsa-miR-3175	CLIP-seq
MIRT779555	hsa-miR-3189-3p	CLIP-seq
MIRT779556	hsa-miR-3194-3p	CLIP-seq
MIRT779557	hsa-miR-3198	CLIP-seq
MIRT779558	hsa-miR-3616-3p	CLIP-seq
MIRT779559	hsa-miR-3661	CLIP-seq
MIRT779560	hsa-miR-3662	CLIP-seq
MIRT779561	hsa-miR-3692	CLIP-seq
MIRT779562	hsa-miR-383	CLIP-seq
MIRT779563	hsa-miR-3921	CLIP-seq
MIRT779564	hsa-miR-4254	CLIP-seq
MIRT779565	hsa-miR-4256	CLIP-seq
MIRT779566	hsa-miR-4276	CLIP-seq
MIRT779567	hsa-miR-4279	CLIP-seq
MIRT779568	hsa-miR-429	CLIP-seq
MIRT779569	hsa-miR-4294	CLIP-seq
MIRT779570	hsa-miR-4309	CLIP-seq
MIRT779571	hsa-miR-4316	CLIP-seq
MIRT779572	hsa-miR-4329	CLIP-seq
MIRT779573	hsa-miR-4434	CLIP-seq
MIRT779574	hsa-miR-4456	CLIP-seq
MIRT779575	hsa-miR-4463	CLIP-seq
MIRT779576	hsa-miR-4499	CLIP-seq
MIRT779577	hsa-miR-4512	CLIP-seq
MIRT779578	hsa-miR-4516	CLIP-seq
MIRT779579	hsa-miR-4520a-3p	CLIP-seq
MIRT779580	hsa-miR-4530	CLIP-seq
MIRT779581	hsa-miR-4649-3p	CLIP-seq
MIRT779582	hsa-miR-4653-5p	CLIP-seq
MIRT779583	hsa-miR-4660	CLIP-seq
MIRT779584	hsa-miR-4674	CLIP-seq
MIRT779585	hsa-miR-4677-3p	CLIP-seq
MIRT779586	hsa-miR-4698	CLIP-seq
MIRT779587	hsa-miR-4706	CLIP-seq
MIRT779588	hsa-miR-4721	CLIP-seq
MIRT779589	hsa-miR-4745-3p	CLIP-seq
MIRT779590	hsa-miR-4749-5p	CLIP-seq
MIRT779591	hsa-miR-4772-5p	CLIP-seq
MIRT779592	hsa-miR-4786-5p	CLIP-seq
MIRT779593	hsa-miR-515-5p	CLIP-seq
MIRT779594	hsa-miR-520d-5p	CLIP-seq
MIRT779595	hsa-miR-524-5p	CLIP-seq
MIRT779596	hsa-miR-544	CLIP-seq
MIRT779597	hsa-miR-548ac	CLIP-seq
MIRT779598	hsa-miR-548ae	CLIP-seq
MIRT779599	hsa-miR-548aj	CLIP-seq
MIRT779600	hsa-miR-548am	CLIP-seq
MIRT779601	hsa-miR-548d-3p	CLIP-seq
MIRT779602	hsa-miR-548x	CLIP-seq
MIRT779603	hsa-miR-548z	CLIP-seq
MIRT779604	hsa-miR-552	CLIP-seq
MIRT779605	hsa-miR-582-5p	CLIP-seq
MIRT779606	hsa-miR-619	CLIP-seq
MIRT779607	hsa-miR-631	CLIP-seq
MIRT779608	hsa-miR-635	CLIP-seq
MIRT779609	hsa-miR-645	CLIP-seq
MIRT779610	hsa-miR-646	CLIP-seq
MIRT779611	hsa-miR-671-3p	CLIP-seq
MIRT779612	hsa-miR-744	CLIP-seq
MIRT779613	hsa-miR-769-5p	CLIP-seq
MIRT1545324	hsa-miR-4326	CLIP-seq
MIRT779538	hsa-miR-1253	CLIP-seq
MIRT779539	hsa-miR-1289	CLIP-seq
MIRT1930062	hsa-miR-208a	CLIP-seq
MIRT1930063	hsa-miR-208b	CLIP-seq
MIRT779546	hsa-miR-23a	CLIP-seq
MIRT779547	hsa-miR-23b	CLIP-seq
MIRT779548	hsa-miR-23c	CLIP-seq
MIRT779552	hsa-miR-3138	CLIP-seq
MIRT779553	hsa-miR-3165	CLIP-seq
MIRT779554	hsa-miR-3175	CLIP-seq
MIRT779556	hsa-miR-3194-3p	CLIP-seq
MIRT1930064	hsa-miR-3194-5p	CLIP-seq
MIRT779557	hsa-miR-3198	CLIP-seq
MIRT1930065	hsa-miR-326	CLIP-seq
MIRT1930066	hsa-miR-330-5p	CLIP-seq
MIRT779558	hsa-miR-3616-3p	CLIP-seq
MIRT779559	hsa-miR-3661	CLIP-seq
MIRT779563	hsa-miR-3921	CLIP-seq
MIRT779564	hsa-miR-4254	CLIP-seq
MIRT779565	hsa-miR-4256	CLIP-seq
MIRT779566	hsa-miR-4276	CLIP-seq
MIRT779567	hsa-miR-4279	CLIP-seq
MIRT1930067	hsa-miR-4286	CLIP-seq
MIRT1930068	hsa-miR-4292	CLIP-seq
MIRT779569	hsa-miR-4294	CLIP-seq
MIRT779570	hsa-miR-4309	CLIP-seq
MIRT779573	hsa-miR-4434	CLIP-seq
MIRT1930069	hsa-miR-4435	CLIP-seq
MIRT779574	hsa-miR-4456	CLIP-seq
MIRT779575	hsa-miR-4463	CLIP-seq
MIRT1930070	hsa-miR-4488	CLIP-seq
MIRT1930071	hsa-miR-4492	CLIP-seq
MIRT1930072	hsa-miR-4498	CLIP-seq
MIRT779577	hsa-miR-4512	CLIP-seq
MIRT779578	hsa-miR-4516	CLIP-seq
MIRT779581	hsa-miR-4649-3p	CLIP-seq
MIRT779582	hsa-miR-4653-5p	CLIP-seq
MIRT1930073	hsa-miR-4697-5p	CLIP-seq
MIRT779587	hsa-miR-4706	CLIP-seq
MIRT779588	hsa-miR-4721	CLIP-seq
MIRT779590	hsa-miR-4749-5p	CLIP-seq
MIRT1930074	hsa-miR-483-3p	CLIP-seq
MIRT779593	hsa-miR-515-5p	CLIP-seq
MIRT1930075	hsa-miR-516b	CLIP-seq
MIRT779606	hsa-miR-619	CLIP-seq
MIRT779607	hsa-miR-631	CLIP-seq
MIRT1930076	hsa-miR-637	CLIP-seq
MIRT779612	hsa-miR-744	CLIP-seq
MIRT1930077	hsa-miR-762	CLIP-seq
MIRT2170872	hsa-miR-1225-3p	CLIP-seq
MIRT2170873	hsa-miR-1233	CLIP-seq
MIRT2170874	hsa-miR-125a-5p	CLIP-seq
MIRT2170875	hsa-miR-125b	CLIP-seq
MIRT2170876	hsa-miR-199a-3p	CLIP-seq
MIRT2170877	hsa-miR-199b-3p	CLIP-seq
MIRT2170878	hsa-miR-2114	CLIP-seq
MIRT779546	hsa-miR-23a	CLIP-seq
MIRT779547	hsa-miR-23b	CLIP-seq
MIRT779548	hsa-miR-23c	CLIP-seq
MIRT2170879	hsa-miR-3129-5p	CLIP-seq
MIRT779556	hsa-miR-3194-3p	CLIP-seq
MIRT779563	hsa-miR-3921	CLIP-seq
MIRT2170880	hsa-miR-4269	CLIP-seq
MIRT779567	hsa-miR-4279	CLIP-seq
MIRT2170881	hsa-miR-4319	CLIP-seq
MIRT2170882	hsa-miR-4446-3p	CLIP-seq
MIRT2170883	hsa-miR-4514	CLIP-seq
MIRT2170884	hsa-miR-4641	CLIP-seq
MIRT779582	hsa-miR-4653-5p	CLIP-seq
MIRT2170885	hsa-miR-4656	CLIP-seq
MIRT2170886	hsa-miR-4692	CLIP-seq
MIRT2170887	hsa-miR-4716-5p	CLIP-seq
MIRT2170888	hsa-miR-4742-5p	CLIP-seq
MIRT2170872	hsa-miR-1225-3p	CLIP-seq
MIRT2170873	hsa-miR-1233	CLIP-seq
MIRT2170874	hsa-miR-125a-5p	CLIP-seq
MIRT2170875	hsa-miR-125b	CLIP-seq
MIRT2170881	hsa-miR-4319	CLIP-seq
MIRT2170884	hsa-miR-4641	CLIP-seq
MIRT2170887	hsa-miR-4716-5p	CLIP-seq
MIRT2443610	hsa-miR-1224-5p	CLIP-seq
MIRT779537	hsa-miR-1236	CLIP-seq
MIRT2443611	hsa-miR-3620	CLIP-seq
MIRT2443612	hsa-miR-4691-5p	CLIP-seq
MIRT2443613	hsa-miR-4725-5p	CLIP-seq
MIRT2443614	hsa-miR-4732-3p	CLIP-seq
MIRT2443615	hsa-miR-4751	CLIP-seq
MIRT2443616	hsa-miR-4765	CLIP-seq
MIRT2443617	hsa-miR-492	CLIP-seq
MIRT2443618	hsa-miR-504	CLIP-seq
MIRT2473482	hsa-miR-1200	CLIP-seq
MIRT779536	hsa-miR-1207-3p	CLIP-seq
MIRT2443610	hsa-miR-1224-5p	CLIP-seq
MIRT779537	hsa-miR-1236	CLIP-seq
MIRT779538	hsa-miR-1253	CLIP-seq
MIRT2170874	hsa-miR-125a-5p	CLIP-seq
MIRT2170875	hsa-miR-125b	CLIP-seq
MIRT779539	hsa-miR-1289	CLIP-seq
MIRT779540	hsa-miR-1294	CLIP-seq
MIRT2473483	hsa-miR-145	CLIP-seq
MIRT779542	hsa-miR-1587	CLIP-seq
MIRT2473484	hsa-miR-198	CLIP-seq
MIRT779545	hsa-miR-2355-5p	CLIP-seq
MIRT779546	hsa-miR-23a	CLIP-seq
MIRT779547	hsa-miR-23b	CLIP-seq
MIRT779548	hsa-miR-23c	CLIP-seq
MIRT779550	hsa-miR-3127-3p	CLIP-seq
MIRT779551	hsa-miR-3135	CLIP-seq
MIRT779552	hsa-miR-3138	CLIP-seq
MIRT779553	hsa-miR-3165	CLIP-seq
MIRT779554	hsa-miR-3175	CLIP-seq
MIRT779555	hsa-miR-3189-3p	CLIP-seq
MIRT779556	hsa-miR-3194-3p	CLIP-seq
MIRT1930064	hsa-miR-3194-5p	CLIP-seq
MIRT779557	hsa-miR-3198	CLIP-seq
MIRT779558	hsa-miR-3616-3p	CLIP-seq
MIRT779559	hsa-miR-3661	CLIP-seq
MIRT779561	hsa-miR-3692	CLIP-seq
MIRT779563	hsa-miR-3921	CLIP-seq
MIRT779564	hsa-miR-4254	CLIP-seq
MIRT779565	hsa-miR-4256	CLIP-seq
MIRT779567	hsa-miR-4279	CLIP-seq
MIRT1930067	hsa-miR-4286	CLIP-seq
MIRT1930068	hsa-miR-4292	CLIP-seq
MIRT779569	hsa-miR-4294	CLIP-seq
MIRT779570	hsa-miR-4309	CLIP-seq
MIRT779571	hsa-miR-4316	CLIP-seq
MIRT2170881	hsa-miR-4319	CLIP-seq
MIRT2473485	hsa-miR-4324	CLIP-seq
MIRT779573	hsa-miR-4434	CLIP-seq
MIRT1930069	hsa-miR-4435	CLIP-seq
MIRT779574	hsa-miR-4456	CLIP-seq
MIRT779575	hsa-miR-4463	CLIP-seq
MIRT1930070	hsa-miR-4488	CLIP-seq
MIRT1930071	hsa-miR-4492	CLIP-seq
MIRT1930072	hsa-miR-4498	CLIP-seq
MIRT779577	hsa-miR-4512	CLIP-seq
MIRT779578	hsa-miR-4516	CLIP-seq
MIRT779580	hsa-miR-4530	CLIP-seq
MIRT779581	hsa-miR-4649-3p	CLIP-seq
MIRT779582	hsa-miR-4653-5p	CLIP-seq
MIRT779583	hsa-miR-4660	CLIP-seq
MIRT779584	hsa-miR-4674	CLIP-seq
MIRT779585	hsa-miR-4677-3p	CLIP-seq
MIRT2443612	hsa-miR-4691-5p	CLIP-seq
MIRT1930073	hsa-miR-4697-5p	CLIP-seq
MIRT779587	hsa-miR-4706	CLIP-seq
MIRT779588	hsa-miR-4721	CLIP-seq
MIRT2443613	hsa-miR-4725-5p	CLIP-seq
MIRT2443614	hsa-miR-4732-3p	CLIP-seq
MIRT779590	hsa-miR-4749-5p	CLIP-seq
MIRT2443615	hsa-miR-4751	CLIP-seq
MIRT2443616	hsa-miR-4765	CLIP-seq
MIRT779592	hsa-miR-4786-5p	CLIP-seq
MIRT1930074	hsa-miR-483-3p	CLIP-seq
MIRT2443617	hsa-miR-492	CLIP-seq
MIRT2443618	hsa-miR-504	CLIP-seq
MIRT2473486	hsa-miR-544b	CLIP-seq
MIRT779606	hsa-miR-619	CLIP-seq
MIRT779607	hsa-miR-631	CLIP-seq
MIRT779608	hsa-miR-635	CLIP-seq
MIRT1930076	hsa-miR-637	CLIP-seq
MIRT779610	hsa-miR-646	CLIP-seq
MIRT2473487	hsa-miR-670	CLIP-seq
MIRT779611	hsa-miR-671-3p	CLIP-seq
MIRT779612	hsa-miR-744	CLIP-seq
MIRT1930077	hsa-miR-762	CLIP-seq
MIRT779613	hsa-miR-769-5p	CLIP-seq
MIRT779537	hsa-miR-1236	CLIP-seq
MIRT779538	hsa-miR-1253	CLIP-seq
MIRT2170874	hsa-miR-125a-5p	CLIP-seq
MIRT2170875	hsa-miR-125b	CLIP-seq
MIRT779539	hsa-miR-1289	CLIP-seq
MIRT779545	hsa-miR-2355-5p	CLIP-seq
MIRT779546	hsa-miR-23a	CLIP-seq
MIRT779547	hsa-miR-23b	CLIP-seq
MIRT779548	hsa-miR-23c	CLIP-seq
MIRT779550	hsa-miR-3127-3p	CLIP-seq
MIRT779552	hsa-miR-3138	CLIP-seq
MIRT779553	hsa-miR-3165	CLIP-seq
MIRT779554	hsa-miR-3175	CLIP-seq
MIRT779556	hsa-miR-3194-3p	CLIP-seq
MIRT1930064	hsa-miR-3194-5p	CLIP-seq
MIRT779557	hsa-miR-3198	CLIP-seq
MIRT779558	hsa-miR-3616-3p	CLIP-seq
MIRT779559	hsa-miR-3661	CLIP-seq
MIRT779563	hsa-miR-3921	CLIP-seq
MIRT779564	hsa-miR-4254	CLIP-seq
MIRT779565	hsa-miR-4256	CLIP-seq
MIRT779567	hsa-miR-4279	CLIP-seq
MIRT1930068	hsa-miR-4292	CLIP-seq
MIRT779569	hsa-miR-4294	CLIP-seq
MIRT779570	hsa-miR-4309	CLIP-seq
MIRT2170881	hsa-miR-4319	CLIP-seq
MIRT779573	hsa-miR-4434	CLIP-seq
MIRT1930069	hsa-miR-4435	CLIP-seq
MIRT779574	hsa-miR-4456	CLIP-seq
MIRT779575	hsa-miR-4463	CLIP-seq
MIRT1930070	hsa-miR-4488	CLIP-seq
MIRT1930071	hsa-miR-4492	CLIP-seq
MIRT1930072	hsa-miR-4498	CLIP-seq
MIRT779577	hsa-miR-4512	CLIP-seq
MIRT779578	hsa-miR-4516	CLIP-seq
MIRT779580	hsa-miR-4530	CLIP-seq
MIRT779581	hsa-miR-4649-3p	CLIP-seq
MIRT779582	hsa-miR-4653-5p	CLIP-seq
MIRT779583	hsa-miR-4660	CLIP-seq
MIRT2443612	hsa-miR-4691-5p	CLIP-seq
MIRT1930073	hsa-miR-4697-5p	CLIP-seq
MIRT779587	hsa-miR-4706	CLIP-seq
MIRT779588	hsa-miR-4721	CLIP-seq
MIRT2443613	hsa-miR-4725-5p	CLIP-seq
MIRT2443614	hsa-miR-4732-3p	CLIP-seq
MIRT779590	hsa-miR-4749-5p	CLIP-seq
MIRT779592	hsa-miR-4786-5p	CLIP-seq
MIRT2443618	hsa-miR-504	CLIP-seq
MIRT779606	hsa-miR-619	CLIP-seq
MIRT779607	hsa-miR-631	CLIP-seq
MIRT1930076	hsa-miR-637	CLIP-seq
MIRT779610	hsa-miR-646	CLIP-seq
MIRT2473487	hsa-miR-670	CLIP-seq
MIRT779612	hsa-miR-744	CLIP-seq
MIRT1930077	hsa-miR-762	CLIP-seq
MIRT779613	hsa-miR-769-5p	CLIP-seq

Show/Hide all (72)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000045	Process	Autophagosome assembly	IBA
GO:0000045	Process	Autophagosome assembly	IDA	20713597, 23202584, 23392225, 23524951, 25891078, 28890335, 33637724
GO:0000045	Process	Autophagosome assembly	IDA	20921139, 23524951
GO:0000045	Process	Autophagosome assembly	IMP	30778222
GO:0000045	Process	Autophagosome assembly	IMP	25215947
GO:0000082	Process	G1/S transition of mitotic cell cycle	IDA	8114739, 18827403, 19237565, 33854232, 33854235, 33854239
GO:0000082	Process	G1/S transition of mitotic cell cycle	TAS	33854239
GO:0000209	Process	Protein polyubiquitination	IDA	30217973
GO:0000423	Process	Mitophagy	IBA
GO:0000423	Process	Mitophagy	IDA	21753002
GO:0000423	Process	Mitophagy	IGI	25215947
GO:0000423	Process	Mitophagy	IMP	25215947
GO:0005515	Function	Protein binding	IPI	20562859, 20921139, 21358617, 22190034, 23524951, 23954414, 23974797, 25127057, 25215947, 25438055, 30217973, 31123703
GO:0005634	Component	Nucleus	IDA	32616651
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IDA	21358617
GO:0005737	Component	Cytoplasm	IDA	17589504
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IDA	21753002
GO:0005739	Component	Mitochondrion	IDA	21358617
GO:0005739	Component	Mitochondrion	IDA	25215947
GO:0005739	Component	Mitochondrion	IEA
GO:0005741	Component	Mitochondrial outer membrane	NAS	25215947
GO:0005776	Component	Autophagosome	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005829	Component	Cytosol	IDA	21753002
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IDA	20921139
GO:0005856	Component	Cytoskeleton	IEA
GO:0005925	Component	Focal adhesion	IEA
GO:0005930	Component	Axoneme	IEA
GO:0005930	Component	Axoneme	ISS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006914	Process	Autophagy	IEA
GO:0006914	Process	Autophagy	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0009267	Process	Cellular response to starvation	IEA
GO:0010508	Process	Positive regulation of autophagy	IDA	21358617, 31123703
GO:0010508	Process	Positive regulation of autophagy	IEA
GO:0010508	Process	Positive regulation of autophagy	IMP	32333458
GO:0010667	Process	Negative regulation of cardiac muscle cell apoptotic process	IEA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0019903	Function	Protein phosphatase binding	IDA	25438055, 30513302
GO:0021915	Process	Neural tube development	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	21753002
GO:0031667	Process	Response to nutrient levels	IEA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	33854232, 33854235, 33854239
GO:0043231	Component	Intracellular membrane-bounded organelle	IBA
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0045335	Component	Phagocytic vesicle	IEA
GO:0045591	Process	Positive regulation of regulatory T cell differentiation	IDA	30513302
GO:0045591	Process	Positive regulation of regulatory T cell differentiation	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	TAS	21753002
GO:0051020	Function	GTPase binding	IPI	25891078
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	21753002
GO:0070161	Component	Anchoring junction	IEA
GO:0072542	Function	Protein phosphatase activator activity	IDA	25438055, 30513302
GO:0080008	Component	Cul4-RING E3 ubiquitin ligase complex	IBA
GO:0080008	Component	Cul4-RING E3 ubiquitin ligase complex	IDA	33854235
GO:0098780	Process	Response to mitochondrial depolarisation	IDA	21753002
GO:0098780	Process	Response to mitochondrial depolarisation	IGI	25215947
GO:1901526	Process	Positive regulation of mitophagy	IDA	30217973
GO:1904544	Process	Positive regulation of free ubiquitin chain polymerization	IDA	31123703
GO:1990756	Function	Ubiquitin-like ligase-substrate adaptor activity	IBA
GO:1990756	Function	Ubiquitin-like ligase-substrate adaptor activity	IDA	23524951, 30166453, 33854232, 33854235, 33854239
GO:2000045	Process	Regulation of G1/S transition of mitotic cell cycle	IDA	25438055

MIM	HGNC	e!Ensembl
611359	25990	ENSG00000110497

Q9C0C7

Protein name

Activating molecule in BECN1-regulated autophagy protein 1 (DDB1- and CUL4-associated factor 3)

Protein function

Substrate-recognition component of a DCX (DDB1-CUL4-X-box) E3 ubiquitin-protein ligase complex involved in cell cycle control and autophagy (PubMed:20921139, PubMed:23524951, PubMed:24587252, PubMed:32333458, PubMed:33854232, PubMed:33854235, Pu

PDB

8WQR

Family and domains

Sequence

MKVVPEKNAVRILWGRERGARAMGAQRLLQELVEDKTRWMKWEGKRVELPDSPRSTFLLA
FSPDRTLLASTHVNHNIYITEVKTGKCVHSLIGHRRTPWCVTFHPTISGLIASGCLDGEV
RIWDLHGGSESWFTDSNNAIASLAFHPTAQLLLIATANEIHFWDWSRREPFAVVKTASEM
ERVRLVRFDPLGHYLLTAIVNPSNQQGDDEPEIPIDGTELSHYRQRALLQSQPVRRTPLL
HNFLHMLSSRSSGIQVGEQSTVQDSATPSPPPPPPQPSTERPRTSAYIRLRQRVSYPTAE
CCQHLGILCLCSRCSGTRVPSLLPHQDSVPPASARATTPSFSFVQTEPFHPPEQASSTQQ
DQGLLNRPSAFSTVQSSTAGNTLRNLSLGPTRRSLGGPLSSHPSRYHREIAPGLTGSEWT
RTVLSLNSRSEAESMPPPRTSASSVSLLSVLRQQEGGSQASVYTSATEGRGFPASGLATE
SDGGNGSSQNNSGSIRHELQCDLRRFFLEYDRLQELDQSLSGEAPQTQQAQEMLNNNIES
ERPGPSHQPTPHSSENNSNLSRGHLNRCRACHNLLTFNNDTLRWERTTPNYSSGEASSSW
QVPSSFESVPSSGSQLPPLERTEGQTPSSSRLELSSSASPQEERTVGVAFNQETGHWERI
YTQSSRSGTVSQEALHQDMPEESSEEDSLRRRLLESSLISLSRYDGAGSREHPIYPDPAR
LSPAAYYAQRMIQYLSRRDSIRQRSMRYQQNRLRSSTSSSSSDNQGPSVEGTDLEFEDFE
DNGDRSRHRAPRNARMSAPSLGRFVPRRFLLPEYLPYAGIFHERGQPGLATHSSVNRVLA
GAVIGDGQSAVASNIANTTYRLQWWDFTKFDLPEISNASVNVLVQNCKIYNDASCDISAD
GQLLAAFIPSSQRGFPDEGILAVYSLAPHNLGEMLYTKRFGPNAISVSLSPMGRYVMVGL
ASRRILLHPSTEHMVAQVFRLQQAHGGETSMRRVFNVLYPMPADQRRHVSINSARWLPEP
GLGLAYGTNKGDLVICRPEALNSGVEYYWDQLNETVFTVHSNSRSSERPGTSRATWRTDR
DMGLMNAIGLQPRNPATSVTSQGTQTLALQLQNAETQTEREVPEPGTAASGPGEGEGSEY
GASGEDALSRIQRLMAEGGMTAVVQREQSTTMASMGGFGNNIIVSHRIHRSSQTGTEPGA
AHTSSPQPSTSRGLLPEAGQLAERGLSPRTASWDQPGTPGREPTQPTLPSSSPVPIPVSL
PSAEGPTLHCELTNNNHLLDGGSSRGDAAGPRGEPRNR

Sequence length

1298

Interactions

View interactions

	KEGG		Reactome
	Mitophagy - animal Autophagy - animal Alzheimer disease Amyotrophic lateral sclerosis Huntington disease Spinocerebellar ataxia Pathways of neurodegeneration - multiple diseases		Macroautophagy

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (20)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Adrenocortical carcinoma, hereditary	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMBRA1-related disorder	Uncertain significance; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANOREXIA NERVOSA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal atresia	Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHIC CARDIOMYOPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neural tube defect	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURAL TUBE DEFECTS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSESSIVE-COMPULSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OCULAR SARCOIDOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pyloric stenosis	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOURETTE SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (36)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Autistic Disorder	Autism	BEFREE	28994820, 30915711		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	31665034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	30027574, 30476925, 30784282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	30476925	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	35656020	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	30836997	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	25197362	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	30614598		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24587252, 36333388	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	38497391	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	26066377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	35128828	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25197362	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30027574, 30476925, 30784282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	29101240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28362576		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	31056744		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	31056744, 34773645, 36243772	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	31056744	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	21921694	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	30513302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25438055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	29755319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	29755319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	29488136		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	30532260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	26763392, 36830707	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	29755319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	29101240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	26423274	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	GWASDB_DG	21747397		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	23551272, 30915711		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	23551272		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	GWASCAT_DG	28991256, 30285260, 31374203		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Selective immunoglobulin A deficiency	Selective Immunoglobulin A Deficiency	BEFREE	27723758		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	33172332	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

AMBRA1 (autophagy and beclin 1 regulator 1)