Gene Gene information from NCBI Gene database.
Entrez ID 55615
Gene name Proline rich 5
Gene symbol PRR5
Synonyms (NCBI Gene)
FLJ20185kPP610PROTOR-1PROTOR1
Chromosome 22
Chromosome location 22q13.31
Summary This gene encodes a protein with a proline-rich domain. This gene is located in a region of chromosome 22 reported to contain a tumor suppressor gene that may be involved in breast and colorectal tumorigenesis. The protein is a component of the mammalian
miRNA miRNA information provided by mirtarbase database.
41
miRTarBase ID miRNA Experiments Reference
MIRT040726 hsa-miR-92b-3p CLASH 23622248
MIRT035827 hsa-miR-1292-5p CLASH 23622248
MIRT1267127 hsa-miR-223 CLIP-seq
MIRT1267128 hsa-miR-3922-5p CLIP-seq
MIRT1267129 hsa-miR-4697-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
12
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 24550280, 28514442, 30126976, 32296183, 33961781, 36931259
GO:0005829 Component Cytosol TAS
GO:0007010 Process Cytoskeleton organization NAS 15268862
GO:0030307 Process Positive regulation of cell growth NAS 22500797
GO:0031669 Process Cellular response to nutrient levels NAS 22500797
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
609406 31682 ENSG00000186654
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P85299
Protein name Proline-rich protein 5 (Protein observed with Rictor-1) (Protor-1)
Protein function Associated subunit of mTORC2, which regulates cell growth and survival in response to hormonal signals (PubMed:17461779, PubMed:17599906, PubMed:29424687). mTORC2 is activated by growth factors, but, in contrast to mTORC1, seems to be nutrient-i
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF08539 HbrB 37 147 HbrB-like Domain
Tissue specificity TISSUE SPECIFICITY: Most abundant in kidney and liver. Also highly expressed in brain, spleen, testis and placenta. Overexpressed in several colorectal tumors. {ECO:0000269|PubMed:15718101, ECO:0000269|PubMed:17599906}.
Sequence
MRTLRRLKFMSSPSLSDLGKREPAAAADERGTQQRRACANATWNSIHNGVIAVFQRKGLP
DQELFSLNEGVRQLLKTELGSFFTEYLQNQLLTKGMVILRDKIRFYEGQKLLDSLAETWD
FFFSDVLPMLQAIFYPVQGKEPSVRQL
ALLHFRNAITLSVKLEDALARAHARVPPAIVQM
LLVLQGVHESRGVTEDYLRLETLVQKVVSPYLGTYGLHSSEGPFTHSCILEKRLLRRSRS
GDVLAKNPVVRSKSYNTPLLNPVQEHEAEGAAAGGTSIRRHSVSEMTSCPEPQGFSDPPG
QGPTGTFRSSPAPHSGPCPSRLYPTTQPPEQGLDPTRSSLPRSSPENLVDQILESVDSDS
EGIFIDFGRGRGSGMSDLEGSGGRQSVV
Sequence length 388
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  mTOR signaling pathway   PIP3 activates AKT signaling
CD28 dependent PI3K/Akt signaling
VEGFR2 mediated vascular permeability
Constitutive Signaling by AKT1 E17K in Cancer
Regulation of TP53 Degradation
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
COLOR VISION DISORDER GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Bipolar Disorder Bipolar disorder Pubtator 29391396 Associate
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma BEFREE 15718101
★☆☆☆☆
Found in Text Mining only
Carcinogenesis Carcinogenesis Pubtator 17599906 Associate
★☆☆☆☆
Found in Text Mining only
Colorectal Carcinoma Colorectal Cancer BEFREE 15718101
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Colorectal Neoplasms BEFREE 15718101
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Colorectal Neoplasms LHGDN 15718101
★☆☆☆☆
Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome Hereditary breast and ovarian cancer syndrome Pubtator 17599906 Associate
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of breast Breast Cancer BEFREE 15718101
★☆☆☆☆
Found in Text Mining only
Mammary Neoplasms Mammary Neoplasms BEFREE 15718101
★☆☆☆☆
Found in Text Mining only
Mammary Neoplasms Mammary Neoplasms LHGDN 15718101
★☆☆☆☆
Found in Text Mining only