Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	55614
Gene name	Kinesin family member 16B
Gene symbol	KIF16B
Synonyms (NCBI Gene)	C20orf23KISC20ORFSNX23
Chromosome	20
Chromosome location	20p12.1
Summary	The protein encoded by this gene is a kinesin-like protein that may be involved in intracellular trafficking. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2010]

Show/Hide all (82)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022782	hsa-miR-124-3p	Microarray	18668037
MIRT025863	hsa-miR-7-5p	Microarray	17612493
MIRT046881	hsa-miR-221-3p	CLASH	23622248
MIRT1093424	hsa-miR-1183	CLIP-seq
MIRT1093425	hsa-miR-1827	CLIP-seq
MIRT1093426	hsa-miR-214	CLIP-seq
MIRT1093427	hsa-miR-3120-5p	CLIP-seq
MIRT1093428	hsa-miR-3180-5p	CLIP-seq
MIRT1093429	hsa-miR-323b-3p	CLIP-seq
MIRT1093430	hsa-miR-330-3p	CLIP-seq
MIRT1093431	hsa-miR-3607-3p	CLIP-seq
MIRT1093432	hsa-miR-3612	CLIP-seq
MIRT1093433	hsa-miR-3619-5p	CLIP-seq
MIRT1093434	hsa-miR-3686	CLIP-seq
MIRT1093435	hsa-miR-4291	CLIP-seq
MIRT1093436	hsa-miR-4328	CLIP-seq
MIRT1093437	hsa-miR-4459	CLIP-seq
MIRT1093438	hsa-miR-4672	CLIP-seq
MIRT1093439	hsa-miR-4693-5p	CLIP-seq
MIRT1093440	hsa-miR-4695-5p	CLIP-seq
MIRT1093441	hsa-miR-4722-5p	CLIP-seq
MIRT1093442	hsa-miR-4778-5p	CLIP-seq
MIRT1093443	hsa-miR-548g	CLIP-seq
MIRT1093444	hsa-miR-650	CLIP-seq
MIRT1093445	hsa-miR-654-3p	CLIP-seq
MIRT1093446	hsa-miR-761	CLIP-seq
MIRT1093447	hsa-miR-765	CLIP-seq
MIRT1093448	hsa-miR-922	CLIP-seq
MIRT1093449	hsa-miR-4293	CLIP-seq
MIRT1093450	hsa-miR-4682	CLIP-seq
MIRT1093451	hsa-miR-498	CLIP-seq
MIRT1093452	hsa-miR-3662	CLIP-seq
MIRT1093453	hsa-miR-4666-3p	CLIP-seq
MIRT1922804	hsa-miR-130a	CLIP-seq
MIRT1922805	hsa-miR-130b	CLIP-seq
MIRT1922806	hsa-miR-221	CLIP-seq
MIRT1922807	hsa-miR-222	CLIP-seq
MIRT1922808	hsa-miR-301a	CLIP-seq
MIRT1922809	hsa-miR-301b	CLIP-seq
MIRT1922810	hsa-miR-323-3p	CLIP-seq
MIRT1922811	hsa-miR-3666	CLIP-seq
MIRT1922812	hsa-miR-4295	CLIP-seq
MIRT1922813	hsa-miR-454	CLIP-seq
MIRT1922814	hsa-miR-519a	CLIP-seq
MIRT1922815	hsa-miR-519b-3p	CLIP-seq
MIRT1922816	hsa-miR-519c-3p	CLIP-seq
MIRT1922817	hsa-miR-548v	CLIP-seq
MIRT1093424	hsa-miR-1183	CLIP-seq
MIRT1093430	hsa-miR-330-3p	CLIP-seq
MIRT1093436	hsa-miR-4328	CLIP-seq
MIRT1093438	hsa-miR-4672	CLIP-seq
MIRT1093439	hsa-miR-4693-5p	CLIP-seq
MIRT1093424	hsa-miR-1183	CLIP-seq
MIRT2256153	hsa-miR-2113	CLIP-seq
MIRT2256154	hsa-miR-218	CLIP-seq
MIRT2256155	hsa-miR-30a	CLIP-seq
MIRT2256156	hsa-miR-30b	CLIP-seq
MIRT2256157	hsa-miR-30c	CLIP-seq
MIRT2256158	hsa-miR-30d	CLIP-seq
MIRT2256159	hsa-miR-30e	CLIP-seq
MIRT2256160	hsa-miR-410	CLIP-seq
MIRT2256161	hsa-miR-4302	CLIP-seq
MIRT2256162	hsa-miR-4514	CLIP-seq
MIRT2256163	hsa-miR-4524	CLIP-seq
MIRT2256164	hsa-miR-4692	CLIP-seq
MIRT1093442	hsa-miR-4778-5p	CLIP-seq
MIRT2256165	hsa-miR-579	CLIP-seq
MIRT2256166	hsa-miR-636	CLIP-seq
MIRT2256163	hsa-miR-4524	CLIP-seq
MIRT2256165	hsa-miR-579	CLIP-seq
MIRT1093424	hsa-miR-1183	CLIP-seq
MIRT1093430	hsa-miR-330-3p	CLIP-seq
MIRT1093436	hsa-miR-4328	CLIP-seq
MIRT1093438	hsa-miR-4672	CLIP-seq
MIRT1093439	hsa-miR-4693-5p	CLIP-seq
MIRT2452573	hsa-miR-146b-3p	CLIP-seq
MIRT2452574	hsa-miR-22	CLIP-seq
MIRT2452575	hsa-miR-3173-5p	CLIP-seq
MIRT2452576	hsa-miR-4300	CLIP-seq
MIRT2452577	hsa-miR-558	CLIP-seq
MIRT2452578	hsa-miR-874	CLIP-seq
MIRT2452579	hsa-miR-920	CLIP-seq

Show/Hide all (43)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001704	Process	Formation of primary germ layer	ISS
GO:0001919	Process	Regulation of receptor recycling	IMP	15882625
GO:0003777	Function	Microtubule motor activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005524	Function	ATP binding	IEA
GO:0005547	Function	Phosphatidylinositol-3,4,5-trisphosphate binding	IDA	15882625, 17641687
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	18445686
GO:0005737	Component	Cytoplasm	IEA
GO:0005768	Component	Endosome	IDA	17641687
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	IDA	15882625
GO:0005819	Component	Spindle	IDA	18445686
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005871	Component	Kinesin complex	IBA
GO:0005874	Component	Microtubule	IBA
GO:0005874	Component	Microtubule	IEA
GO:0006895	Process	Golgi to endosome transport	ISS
GO:0007018	Process	Microtubule-based movement	IEA
GO:0007169	Process	Cell surface receptor protein tyrosine kinase signaling pathway	IEA
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IMP	15882625
GO:0007492	Process	Endoderm development	ISS
GO:0008017	Function	Microtubule binding	IBA
GO:0008017	Function	Microtubule binding	IEA
GO:0008289	Function	Lipid binding	IEA
GO:0008543	Process	Fibroblast growth factor receptor signaling pathway	ISS
GO:0008574	Function	Plus-end-directed microtubule motor activity	IBA
GO:0008574	Function	Plus-end-directed microtubule motor activity	IDA	15882625
GO:0016020	Component	Membrane	IEA
GO:0016192	Process	Vesicle-mediated transport	IEA
GO:0016887	Function	ATP hydrolysis activity	IBA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031901	Component	Early endosome membrane	IEA
GO:0032266	Function	Phosphatidylinositol-3-phosphate binding	IDA	15882625
GO:0032801	Process	Receptor catabolic process	IMP	15882625
GO:0035091	Function	Phosphatidylinositol binding	IEA
GO:0043325	Function	Phosphatidylinositol-3,4-bisphosphate binding	IDA	15882625, 17641687
GO:0045022	Process	Early endosome to late endosome transport	IMP	15882625
GO:0047496	Process	Vesicle transport along microtubule	IBA
GO:0080025	Function	Phosphatidylinositol-3,5-bisphosphate binding	IDA	17641687

MIM	HGNC	e!Ensembl
618171	15869	ENSG00000089177

Q96L93

Protein name

Kinesin-like protein KIF16B (Sorting nexin-23)

Protein function

Plus end-directed microtubule-dependent motor protein involved in endosome transport and receptor recycling and degradation. Regulates the plus end motility of early endosomes and the balance between recycling and degradation of receptors such a

PDB

2V14 , 6EE0

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00225	Kinesin	9 → 358	Kinesin motor domain	Domain
PF00498	FHA	478 → 544	FHA domain	Family
PF00787	PX	1209 → 1283	PX domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Primarily expressed in brain. Also present in kidney, liver, intestine, placenta, leukocytes, heart and skeletal muscle (at protein level). {ECO:0000269|PubMed:15882625}.

Sequence

MASVKVAVRVRPMNRREKDLEAKFIIQMEKSKTTITNLKIPEGGTGDSGRERTKTFTYDF
SFYSADTKSPDYVSQEMVFKTLGTDVVKSAFEGYNACVFAYGQTGSGKSYTMMGNSGDSG
LIPRICEGLFSRINETTRWDEASFRTEVSYLEIYNERVRDLLRRKSSKTFNLRVREHPKE
GPYVEDLSKHLVQNYGDVEELMDAGNINRTTAATGMNDVSSRSHAIFTIKFTQAKFDSEM
PCETVSKIHLVDLAGSERADATGATGVRLKEGGNINKSLVTLGNVISALADLSQDAANTL
AKKKQVFVPYRDSVLTWLLKDSLGGNSKTIMIATISPADVNYGETLSTLRYANRAKNIIN
KPTINEDANVKLIRELRAEIARLKTLLAQGNQIALLDSPTALSMEEKLQQNEARVQELTK
EWTNKWNETQNILKEQTLALRKEGIGVVLDSELPHLIGIDDDLLSTGIILYHLKEGQTYV
GRDDASTEQDIVLHGLDLESEHCIFENIGGTVTLIPLSGSQCSVNGVQIVEATHLNQGAV
ILLGRTNMFRFNHPKEAAKLREKRKSGLLSSFSLSMTDLSKSRENLSAVMLYNPGLEFER
QQREELEKLESKRKLIEEMEEKQKSDKAELERMQQEVETQRKETEIVQLQIRKQEESLKR
RSFHIENKLKDLLAEKEKFEEERLREQQEIELQKKRQEEETFLRVQEELQRLKELNNNEK
AEKFQIFQELDQLQKEKDEQYAKLELEKKRLEEQEKEQVMLVAHLEEQLREKQEMIQLLR
RGEVQWVEEEKRDLEGIRESLLRVKEARAGGDEDGEELEKAQLRFFEFKRRQLVKLVNLE
KDLVQQKDILKKEVQEEQEILECLKCEHDKESRLLEKHDESVTDVTEVPQDFEKIKPVEY
RLQYKERQLQYLLQNHLPTLLEEKQRAFEILDRGPLSLDNTLYQVEKEMEEKEEQLAQYQ
ANANQLQKLQATFEFTANIARQEEKVRKKEKEILESREKQQREALERALARLERRHSALQ
RHSTLGMEIEEQRQKLASLNSGSREQSGLQASLEAEQEALEKDQERLEYEIQQLKQKIYE
VDGVQKDHHGTLEGKVASSSLPVSAEKSHLVPLMDARINAYIEEEVQRRLQDLHRVISEG
CSTSADTMKDNEKLHNGTIQRKLKYERMVSRSLGANPDDLKDPIKISIPRYVLCGQGKDA
HFEFEVKITVLDETWTVFRRYSRFREMHKTLKLKYAELAALEFPPKKLFGNKDERVIAER
RSHLEKYLRDFFSVMLQSATSPLHINKVGLTLSKHTICEFSPFFKKGVFDYSSHGTG

Sequence length

1317

Interactions

View interactions

	KEGG		Reactome
	Motor proteins		COPI-dependent Golgi-to-ER retrograde traffic Kinesins

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (11)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOID TUMOR	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HODGKINS LYMPHOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIF16B-related Intellectual Disability	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Muscular atrophy	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (13)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	29986997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	GWASCAT_DG	27611488		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	26573232	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35487942	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Fibrosis of the Extraocular Muscles	Congenital fibrosis of extraocular muscles	BEFREE	16157808, 19551685, 24715754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	29736960		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	19717019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Limb Deformities, Congenital	Congenital anomaly of limb	BEFREE	31698100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Mobius Syndrome	Mobius Syndrome	BEFREE	24715754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	31618441		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	31618441	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	35715463	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

KIF16B (kinesin family member 16B)