Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	55601
Gene name	DExD/H-box helicase 60
Gene symbol	DDX60
Synonyms (NCBI Gene)	-
Chromosome	4
Chromosome location	4q32.3
Summary	DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases which are implicated in a number of cellular procsses involving RNA binding and alteration of RNA secondary structure. This gene encodes a DEXD/H bo

Show/Hide all (63)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023901	hsa-miR-1-3p	Microarray	18668037
MIRT029819	hsa-miR-26b-5p	Microarray	19088304
MIRT1975622	hsa-miR-142-5p	CLIP-seq
MIRT1975623	hsa-miR-3117-5p	CLIP-seq
MIRT1975624	hsa-miR-4450	CLIP-seq
MIRT1975625	hsa-miR-4667-5p	CLIP-seq
MIRT1975626	hsa-miR-4700-5p	CLIP-seq
MIRT1975627	hsa-miR-4704-3p	CLIP-seq
MIRT1975628	hsa-miR-561	CLIP-seq
MIRT1975622	hsa-miR-142-5p	CLIP-seq
MIRT2211142	hsa-miR-145	CLIP-seq
MIRT2211143	hsa-miR-300	CLIP-seq
MIRT1975623	hsa-miR-3117-5p	CLIP-seq
MIRT2211144	hsa-miR-3180-5p	CLIP-seq
MIRT2211145	hsa-miR-381	CLIP-seq
MIRT2211146	hsa-miR-4275	CLIP-seq
MIRT2211147	hsa-miR-433	CLIP-seq
MIRT1975624	hsa-miR-4450	CLIP-seq
MIRT2211148	hsa-miR-4666-3p	CLIP-seq
MIRT1975625	hsa-miR-4667-5p	CLIP-seq
MIRT1975626	hsa-miR-4700-5p	CLIP-seq
MIRT1975627	hsa-miR-4704-3p	CLIP-seq
MIRT2211149	hsa-miR-496	CLIP-seq
MIRT1975628	hsa-miR-561	CLIP-seq
MIRT2211150	hsa-miR-656	CLIP-seq
MIRT2211151	hsa-miR-664	CLIP-seq
MIRT2211152	hsa-miR-758	CLIP-seq
MIRT1975622	hsa-miR-142-5p	CLIP-seq
MIRT1975623	hsa-miR-3117-5p	CLIP-seq
MIRT1975624	hsa-miR-4450	CLIP-seq
MIRT1975625	hsa-miR-4667-5p	CLIP-seq
MIRT1975626	hsa-miR-4700-5p	CLIP-seq
MIRT1975628	hsa-miR-561	CLIP-seq
MIRT2211150	hsa-miR-656	CLIP-seq
MIRT2515031	hsa-miR-1273f	CLIP-seq
MIRT1975622	hsa-miR-142-5p	CLIP-seq
MIRT2515032	hsa-miR-143	CLIP-seq
MIRT1975623	hsa-miR-3117-5p	CLIP-seq
MIRT2515033	hsa-miR-371-5p	CLIP-seq
MIRT2515034	hsa-miR-4324	CLIP-seq
MIRT1975624	hsa-miR-4450	CLIP-seq
MIRT1975625	hsa-miR-4667-5p	CLIP-seq
MIRT2515035	hsa-miR-4699-3p	CLIP-seq
MIRT1975626	hsa-miR-4700-5p	CLIP-seq
MIRT1975627	hsa-miR-4704-3p	CLIP-seq
MIRT2515036	hsa-miR-4708-5p	CLIP-seq
MIRT2515037	hsa-miR-4770	CLIP-seq
MIRT2515038	hsa-miR-543	CLIP-seq
MIRT2515039	hsa-miR-548c-3p	CLIP-seq
MIRT1975628	hsa-miR-561	CLIP-seq
MIRT2211150	hsa-miR-656	CLIP-seq
MIRT1975622	hsa-miR-142-5p	CLIP-seq
MIRT1975623	hsa-miR-3117-5p	CLIP-seq
MIRT2515033	hsa-miR-371-5p	CLIP-seq
MIRT1975624	hsa-miR-4450	CLIP-seq
MIRT1975625	hsa-miR-4667-5p	CLIP-seq
MIRT2515035	hsa-miR-4699-3p	CLIP-seq
MIRT1975626	hsa-miR-4700-5p	CLIP-seq
MIRT1975627	hsa-miR-4704-3p	CLIP-seq
MIRT2515038	hsa-miR-543	CLIP-seq
MIRT2515039	hsa-miR-548c-3p	CLIP-seq
MIRT1975628	hsa-miR-561	CLIP-seq
MIRT2211150	hsa-miR-656	CLIP-seq

Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0002376	Process	Immune system process	IEA
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003690	Function	Double-stranded DNA binding	IDA	21791617
GO:0003723	Function	RNA binding	IEA
GO:0003724	Function	RNA helicase activity	IEA
GO:0003725	Function	Double-stranded RNA binding	IBA
GO:0003725	Function	Double-stranded RNA binding	IDA	21791617
GO:0003727	Function	Single-stranded RNA binding	IBA
GO:0003727	Function	Single-stranded RNA binding	IDA	21791617
GO:0004386	Function	Helicase activity	IEA
GO:0005515	Function	Protein binding	IPI	21791617, 30833792
GO:0005524	Function	ATP binding	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	21791617
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0009615	Process	Response to virus	IDA	21791617
GO:0016787	Function	Hydrolase activity	IEA
GO:0016887	Function	ATP hydrolysis activity	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0045111	Component	Intermediate filament cytoskeleton	IDA
GO:0051607	Process	Defense response to virus	IBA
GO:0051607	Process	Defense response to virus	IEA
GO:0051607	Process	Defense response to virus	IEA
GO:1900245	Process	Positive regulation of MDA-5 signaling pathway	IMP	21791617
GO:1900246	Process	Positive regulation of RIG-I signaling pathway	IMP	21791617

MIM	HGNC	e!Ensembl
613974	25942	ENSG00000137628

Q8IY21

Protein name

Probable ATP-dependent RNA helicase DDX60 (EC 3.6.4.13) (DEAD box protein 60)

Protein function

Positively regulates RIGI- and IFIH1/MDA5-dependent type I interferon and interferon inducible gene expression in response to viral infection. Binds ssRNA, dsRNA and dsDNA and can promote the binding of RIGI to dsRNA. Exhibits antiviral activity

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00270	DEAD	765 → 927	DEAD/DEAH box helicase	Domain
PF00271	Helicase_C	1218 → 1330	Helicase conserved C-terminal domain	Family

Tissue specificity

TISSUE SPECIFICITY: Brain, lymph node, prostate, stomach, thyroid, tongue, trachea, uterus, skeletal muscle, spleen, kidney, liver and small intestine. {ECO:0000269|PubMed:21791617}.

Sequence

MERNVLTTFSQEMSQLILNEMPKAEYSSLFNDFVESEFFLIDGDSLLITCICEISFKPGQ
NLHFFYLVERYLVDLISKGGQFTIVFFKDAEYAYFNFPELLSLRTALILHLQKNTTIDVR
TTFSRCLSKEWGSFLEESYPYFLIVADEGLNDLQTQLFNFLIIHSWARKVNVVLSSGQES
DVLCLYAYLLPSMYRHQIFSWKNKQNIKDAYTTLLNQLERFKLSALAPLFGSLKWNNITE
EAHKTVSLLTQVWPEGSDIRRVFCVTSCSLSLRMYHRFLGNREPSSGQETEIQQVNSNCL
TLQEMEDLCKLHCLTVVFLLHLPLSQRACARVITSHWAEDMKPLLQMKKWCEYFILRNIH
TFEFWNLNLIHLSDLNDELLLKNIAFYYENENVKGLHLNLGDTIMKDYEYLWNTVSKLVR
DFEVGQPFPLRTTKVCFLEKKPSPIKDSSNEMVPNLGFIPTSSFVVDKFAGDILKDLPFL
KSDDPIVTSLVKQKEFDELVHWHSHKPLSDDYDRSRCQFDEKSRDPRVLRSVQKYHVFQR
FYGNSLETVSSKIIVTQTIKSKKDFSGPKSKKAHETKAEIIARENKKRLFAREEQKEEQK
WNALSFSIEEQLKENLHSGIKSLEDFLKSCKSSCVKLQVEMVGLTACLKAWKEHCRSEEG
KTTKDLSIAVQVMKRIHSLMEKYSELLQEDDRQLIARCLKYLGFDELASSLHPAQDAEND
VKVKKRNKYSVGIGPARFQLQYMGHYLIRDERKDPDPRVQDFIPDTWQRELLDVVDKNES
AVIVAPTSSGKTYASYYCMEKVLKESDDGVVVYVAPTKALVNQVAATVQNRFTKNLPSGE
VLCGVFTREYRHDALNCQVLITVPACFEILLLAPHRQNWVKKIRYVIFDEVHCLGGEIGA
EIWEHLLVMIRCPFLALSATISNPEHLTEWLQSVKWYWKQEDKIIENNTASKRHVGRQAG
FPKDYLQVKQSYKVRLVLYGERYNDLEKHVCSIKHGDIHFDHFHPCAALTTDHIERYGFP
PDLTLSPRESIQLYDAMFQIWKSWPRAQELCPENFIHFNNKLVIKKMDARKYEESLKAEL
TSWIKNGNVEQARMVLQNLSPEADLSPENMITMFPLLVEKLRKMEKLPALFFLFKLGAVE
NAAESVSTFLKKKQETKRPPKADKEAHVMANKLRKVKKSIEKQKIIDEKSQKKTRNVDQS
LIHEAEHDNLVKCLEKNLEIPQDCTYADQKAVDTETLQKVFGRVKFERKGEELKALAERG
IGYHHSAMSFKEKQLVEILFRKGYLRVVTATGTLALGVNMPCKSVVFAQNSVYLDALNYR
QMSGRAGRRGQDLMGDVYFFDIPFPKIGKLIKSNVPELRGHFPLSITLVLRLMLLASKGD
DPEDAKAKVLSVLKHSLLSFKQPRVMDMLKLYFLFSLQFLVKEGYLDQEGNPMGFAGLVS
HLHYHEPSNLVFVSFLVNGLFHDLCQPTRKGSKHFSQDVMEKLVLVLAHLFGRRYFPPKF
QDAHFEFYQSKVFLDDLPEDFSDALDEYNMKIMEDFTTFLRIVSKLADMNQEYQLPLSKI
KFTGKECEDSQLVSHLMSCKEGRVAISPFVCLSGNFDDDLLRLETPNHVTLGTIGVNRSQ
APVLLSQKFDNRGRKMSLNAYALDFYKHGSLIGLVQDNRMNEGDAYYLLKDFALTIKSIS
VSLRELCENEDDNVVLAFEQLSTTFWEKLNKV

Sequence length

1712

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (15)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Carcinogenesis	Carcinogenesis	Pubtator	27835882	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	27835882		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	29321042, 36655136	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	35392757	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	39844327	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	27835882		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mixed Connective Tissue Disease	Mixed connective tissue disease	Pubtator	31440254	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	34384424	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	27835882		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	39844327	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	39844327	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	27835882		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	27835882, 38287816	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lip	Carcinoma of Lip	BEFREE	27835882		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	27835882		★★★★★ ★☆☆☆☆ Found in Text Mining only

DDX60 (DExD/H-box helicase 60)