Gene Gene information from NCBI Gene database.
Entrez ID 55591
Gene name Vezatin, adherens junctions transmembrane protein
Gene symbol VEZT
Synonyms (NCBI Gene)
VEZATIN
Chromosome 12
Chromosome location 12q22
Summary This gene encodes a transmembrane protein which has been localized to adherens junctions and shown to bind to myosin VIIA. Examination of expression of this gene in gastric cancer tissues have shown that expression is decreased which appears to be related
miRNA miRNA information provided by mirtarbase database.
403
miRTarBase ID miRNA Experiments Reference
MIRT004780 hsa-miR-30a-3p Luciferase reporter assayqRT-PCRWestern blot 16239240
MIRT019856 hsa-miR-375 Microarray 20215506
MIRT027075 hsa-miR-103a-3p Sequencing 20371350
MIRT027346 hsa-miR-101-3p Sequencing 20371350
MIRT004780 hsa-miR-30a-3p qRT-PCR 16239240
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
16
GO ID Ontology Definition Evidence Reference
GO:0001669 Component Acrosomal vesicle IEA
GO:0002142 Component Stereocilia ankle link complex ISS
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IDA
GO:0005829 Component Cytosol IDA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
619749 18258 ENSG00000028203
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9HBM0
Protein name Vezatin
Protein function Plays a pivotal role in the establishment of adherens junctions and their maintenance in adult life. Required for morphogenesis of the preimplantation embryo, and for the implantation process. ; (Microbia
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12632 Vezatin 150 438 Mysoin-binding motif of peroxisomes Family
Sequence
MTPEFDEEVVFENSPLYQYLQDLGHTDFEICSSLSPKTEKCTTEGQQKPPTRVLPKQGIL
LKVAETIKSWIFFSQCNKKDDLLHKLDIGFRLDSLHTILQQEVLLQEDVELIELLDPSIL
SAGQSQQQENGHLPTLCSLATPNIWDLSMLFAFISLLVMLPTWWIVSSWLVWGVILFVYL
VIRALRLWRTAKLQVTLKKYSVHLEDMATNSRAFTNLVRKALRLIQETEVISRGFTLVSA
ACPFNKAGQHPSQHLIGLRKAVYRTLRANFQAARLATLYMLKNYPLNSESDNVTNYICVV
PFKELGLGLSEEQISEEEAHNFTDGFSLPALKVLFQLWVAQSSEFFRRLALLLSTANSPP
GPLLTPALLPHRILSDVTQGLPHAHSACLEELKRSYEFYRYFETQHQSVPQCLSKTQQKS
RELNNVHTAVRSLQLHLK
ALLNEVIILEDELEKLVCTKETQELVSEAYPILEQKLKLIQP
HVQASNNCWEEAISQVDKLLRRNTDKKGKPEIACENPHCTVVPLKQPTLHIADKDPIPEE
QELEAYVDDIDIDSDFRKDDFYYLSQEDKERQKREHEESKRVLQELKSVLGFKASEAERQ
KWKQLLFSDHAVLKSLSPVDPVEPISNSEPSMNSDMGKVSKNDTEEESNKSATTDNEISR
TEYLCENSLEGKNKDNSSNEVFPQGAEERMCYQCESEDEPQADGSGLTTAPPTPRDSLQP
SIKQRLARLQLSPDFTFTAGLAAEVAARSLSFTTMQEQTFGGEEEEQIIEENKNEIEEK
Sequence length 779
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ENDOMETRIOSIS GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Endometriosis Endometriosis BEFREE 23104006, 25678572, 27005890, 28901453, 30061686
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Endometriosis Endometriosis GWASDB_DG 23104006
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Endometriosis Endometriosis GWASCAT_DG 28537267
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Endometriosis Endometriosis Pubtator 28901453, 30061686 Associate
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Lymphatic Metastasis Lymphatic Metastasis BEFREE 25792470
★☆☆☆☆
Found in Text Mining only
Lymphatic Metastasis Lymphatic metastasis Pubtator 25792470 Associate
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of stomach Stomach Neoplasms BEFREE 21156161, 25792470
★☆☆☆☆
Found in Text Mining only
Malignant Neoplasms Malignant Neoplasm BEFREE 21156161
★☆☆☆☆
Found in Text Mining only
Neoplasms Neoplasms BEFREE 25792470
★☆☆☆☆
Found in Text Mining only
Obesity Obesity Pubtator 32071425 Associate
★☆☆☆☆
Found in Text Mining only