Gene Gene information from NCBI Gene database.
Entrez ID 55573
Gene name CDV3 homolog
Gene symbol CDV3
Synonyms (NCBI Gene)
H41
Chromosome 3
Chromosome location 3q22.1
miRNA miRNA information provided by mirtarbase database.
1073
miRTarBase ID miRNA Experiments Reference
MIRT020366 hsa-miR-29c-3p Sequencing 20371350
MIRT022693 hsa-miR-124-3p Microarray 18668037
MIRT027064 hsa-miR-103a-3p Sequencing 20371350
MIRT031715 hsa-miR-16-5p Sequencing 20371350
MIRT049414 hsa-miR-92a-3p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
4
GO ID Ontology Definition Evidence Reference
GO:0005737 Component Cytoplasm IBA
GO:0005737 Component Cytoplasm IEA
GO:0005829 Component Cytosol IDA
GO:0005886 Component Plasma membrane IDA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
618789 26928 ENSG00000091527
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UKY7
Protein name Protein CDV3 homolog
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15359 CDV3 81 203 Carnitine deficiency-associated protein 3 Family
Tissue specificity TISSUE SPECIFICITY: Expression levels correlate with those of HER-2/neu in breast cancer cells. {ECO:0000269|PubMed:10497265}.
Sequence
MAETEERSLDNFFAKRDKKKKKERSNRAASAAGAAGSAGGSSGAAGAAGGGAGAGTRPGD
GGTASAGAAGPGAATKAVTKDEDEWKELEQKEVDYSGLRVQAMQISSEKEEDDNEKRQDP
GDNWEEGGGGGGGMEKSSGPWNKTAPVQAPPAPVIVTETPEPAMTSGVYRPPGARLTTTR
KTPQGPPEIYSDTQFPSLQSTAK
HVESRKDKEMEKSFEVVRHKNRGRDEVSKNQALKLQL
DNQYAVLENQKSSHSQYN
Sequence length 258
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
OLIGODENDROGLIOMA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Colorectal Carcinoma Colorectal Cancer BEFREE 21811255
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Colorectal neoplasm Pubtator 21811255 Associate
★☆☆☆☆
Found in Text Mining only