Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	55536
Gene name	Cell division cycle associated 7 like
Gene symbol	CDCA7L
Synonyms (NCBI Gene)	JPO2R1RAM2
Chromosome	7
Chromosome location	7p15.3

117

Show/Hide all (117)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019850	hsa-miR-375	Microarray	20215506
MIRT002722	hsa-miR-124-3p	Microarray	15685193
MIRT002722	hsa-miR-124-3p	Proteomics	18668037
MIRT041933	hsa-miR-484	CLASH	23622248
MIRT879064	hsa-miR-129-3p	CLIP-seq
MIRT879065	hsa-miR-3163	CLIP-seq
MIRT879066	hsa-miR-3613-3p	CLIP-seq
MIRT879067	hsa-miR-371b-5p	CLIP-seq
MIRT879068	hsa-miR-4687-5p	CLIP-seq
MIRT879069	hsa-miR-4698	CLIP-seq
MIRT879070	hsa-miR-499-3p	CLIP-seq
MIRT879071	hsa-miR-499a-3p	CLIP-seq
MIRT879072	hsa-miR-548k	CLIP-seq
MIRT879073	hsa-miR-548n	CLIP-seq
MIRT879074	hsa-miR-607	CLIP-seq
MIRT879075	hsa-miR-938	CLIP-seq
MIRT879076	hsa-miR-1238	CLIP-seq
MIRT879077	hsa-miR-1294	CLIP-seq
MIRT879078	hsa-miR-3198	CLIP-seq
MIRT879066	hsa-miR-3613-3p	CLIP-seq
MIRT879079	hsa-miR-3622a-5p	CLIP-seq
MIRT879080	hsa-miR-3652	CLIP-seq
MIRT879081	hsa-miR-371-5p	CLIP-seq
MIRT879067	hsa-miR-371b-5p	CLIP-seq
MIRT879082	hsa-miR-4309	CLIP-seq
MIRT879083	hsa-miR-431	CLIP-seq
MIRT879084	hsa-miR-4423-3p	CLIP-seq
MIRT879085	hsa-miR-4430	CLIP-seq
MIRT879086	hsa-miR-4505	CLIP-seq
MIRT879087	hsa-miR-4537	CLIP-seq
MIRT879088	hsa-miR-4652-3p	CLIP-seq
MIRT879089	hsa-miR-4710	CLIP-seq
MIRT879090	hsa-miR-4792	CLIP-seq
MIRT879070	hsa-miR-499-3p	CLIP-seq
MIRT879071	hsa-miR-499a-3p	CLIP-seq
MIRT879091	hsa-miR-548c-3p	CLIP-seq
MIRT879072	hsa-miR-548k	CLIP-seq
MIRT879073	hsa-miR-548n	CLIP-seq
MIRT879092	hsa-miR-586	CLIP-seq
MIRT879093	hsa-miR-767-5p	CLIP-seq
MIRT879094	hsa-miR-1285	CLIP-seq
MIRT879095	hsa-miR-1343	CLIP-seq
MIRT879096	hsa-miR-1470	CLIP-seq
MIRT879097	hsa-miR-3187-5p	CLIP-seq
MIRT879098	hsa-miR-4469	CLIP-seq
MIRT879099	hsa-miR-4667-3p	CLIP-seq
MIRT879100	hsa-miR-4793-3p	CLIP-seq
MIRT879101	hsa-miR-612	CLIP-seq
MIRT879093	hsa-miR-767-5p	CLIP-seq
MIRT1920351	hsa-miR-4501	CLIP-seq
MIRT879070	hsa-miR-499-3p	CLIP-seq
MIRT879071	hsa-miR-499a-3p	CLIP-seq
MIRT879072	hsa-miR-548k	CLIP-seq
MIRT879073	hsa-miR-548n	CLIP-seq
MIRT1920352	hsa-miR-548t	CLIP-seq
MIRT1920351	hsa-miR-4501	CLIP-seq
MIRT879070	hsa-miR-499-3p	CLIP-seq
MIRT879071	hsa-miR-499a-3p	CLIP-seq
MIRT879072	hsa-miR-548k	CLIP-seq
MIRT879073	hsa-miR-548n	CLIP-seq
MIRT1920352	hsa-miR-548t	CLIP-seq
MIRT1960590	hsa-miR-1185	CLIP-seq
MIRT1960591	hsa-miR-125a-3p	CLIP-seq
MIRT1960592	hsa-miR-139-5p	CLIP-seq
MIRT1960593	hsa-miR-15a	CLIP-seq
MIRT1960594	hsa-miR-15b	CLIP-seq
MIRT1960595	hsa-miR-16	CLIP-seq
MIRT1960596	hsa-miR-195	CLIP-seq
MIRT1960597	hsa-miR-214	CLIP-seq
MIRT1960598	hsa-miR-25	CLIP-seq
MIRT1960599	hsa-miR-302f	CLIP-seq
MIRT1960600	hsa-miR-32	CLIP-seq
MIRT1960601	hsa-miR-342-3p	CLIP-seq
MIRT1960602	hsa-miR-3605-5p	CLIP-seq
MIRT1960603	hsa-miR-3619-5p	CLIP-seq
MIRT1960604	hsa-miR-363	CLIP-seq
MIRT1960605	hsa-miR-367	CLIP-seq
MIRT1960606	hsa-miR-3679-5p	CLIP-seq
MIRT1960607	hsa-miR-424	CLIP-seq
MIRT1960608	hsa-miR-4325	CLIP-seq
MIRT1960609	hsa-miR-4690-5p	CLIP-seq
MIRT1960610	hsa-miR-4726-3p	CLIP-seq
MIRT1960611	hsa-miR-497	CLIP-seq
MIRT1960612	hsa-miR-548g	CLIP-seq
MIRT1960613	hsa-miR-582-5p	CLIP-seq
MIRT1960614	hsa-miR-761	CLIP-seq
MIRT1960615	hsa-miR-802	CLIP-seq
MIRT1960616	hsa-miR-92a	CLIP-seq
MIRT1960617	hsa-miR-92b	CLIP-seq
MIRT2500536	hsa-let-7a	CLIP-seq
MIRT2500537	hsa-let-7b	CLIP-seq
MIRT2500538	hsa-let-7c	CLIP-seq
MIRT2500539	hsa-let-7d	CLIP-seq
MIRT2500540	hsa-let-7e	CLIP-seq
MIRT2500541	hsa-let-7f	CLIP-seq
MIRT2500542	hsa-let-7g	CLIP-seq
MIRT2500543	hsa-let-7i	CLIP-seq
MIRT2500544	hsa-miR-122	CLIP-seq
MIRT2500545	hsa-miR-1251	CLIP-seq
MIRT2500546	hsa-miR-1256	CLIP-seq
MIRT2500547	hsa-miR-1287	CLIP-seq
MIRT2500548	hsa-miR-1305	CLIP-seq
MIRT2500549	hsa-miR-3135b	CLIP-seq
MIRT879066	hsa-miR-3613-3p	CLIP-seq
MIRT2500550	hsa-miR-362-5p	CLIP-seq
MIRT879081	hsa-miR-371-5p	CLIP-seq
MIRT879067	hsa-miR-371b-5p	CLIP-seq
MIRT2500551	hsa-miR-4432	CLIP-seq
MIRT2500552	hsa-miR-4458	CLIP-seq
MIRT2500553	hsa-miR-4500	CLIP-seq
MIRT2500554	hsa-miR-500b	CLIP-seq
MIRT2500555	hsa-miR-501-5p	CLIP-seq
MIRT2500556	hsa-miR-517b	CLIP-seq
MIRT879072	hsa-miR-548k	CLIP-seq
MIRT879073	hsa-miR-548n	CLIP-seq
MIRT2500557	hsa-miR-95	CLIP-seq
MIRT2500558	hsa-miR-98	CLIP-seq

Show/Hide all (11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001650	Component	Fibrillar center	IDA
GO:0005515	Function	Protein binding	IPI	24705354, 25082813, 25416956, 25910212, 26871637, 27229929, 28169274, 29892012, 29997176, 32296183, 32814053
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	15994933
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	15994933

MIM	HGNC	e!Ensembl
609685	30777	ENSG00000164649

Q96GN5

Protein name

Cell division cycle-associated 7-like protein (Protein JPO2) (Transcription factor RAM2)

Protein function

Plays a role in transcriptional regulation as a repressor that inhibits monoamine oxidase A (MAOA) activity and gene expression by binding to the promoter. Plays an important oncogenic role in mediating the full transforming effect of MYC in med

PDB

5YI9 , 6EMO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10497	zf-4CXXC_R1	345 → 443	Zinc-finger domain of monoamine-oxidase A repressor R1	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. Overexpressed in medulloblastoma. {ECO:0000269|PubMed:15654081, ECO:0000269|PubMed:15994933}.

Sequence

MELATRYQIPKEVADIFNAPSDDEEFVGFRDDVPMETLSSEESCDSFDSLESGKQQDVRF
HSKYFTEELRRIFIEDTDSETEDFAGFTQSDLNGKTNPEVMVVESDLSDDGKASLVSEEE
EDEEEDKATPRRSRSRRSSIGLRVAFQFPTKKLANKPDKNSSSEQLFSSARLQNEKKTIL
ERKKDCRQVIQREDSTSESEDDSRDESQESSDALLKRTMNIKENKAMLAQLLAELNSMPD
FFPVRTPTSASRKKTVRRAFSEGQITRRMNPTRSARPPEKFALENFTVSAAKFAEEFYSF
RRRKTIGGKCREYRRRHRISSFRPVEDITEEDLENVAITVRDKIYDKVLGNTCHQCRQKT
IDTKTVCRNQGCCGVRGQFCGPCLRNRYGEDVRSALLDPDWVCPPCRGICNCSYCRKRDG
RCATGILIHLAKFYGYDNVKEYLESLQKELVEDN

Sequence length

454

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (14)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CILIARY DYSKINESIA, PRIMARY, 7	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CILIARY MOTILITY DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONNECTIVE TISSUE DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CUTANEOUS MELANOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SITUS INVERSUS TOTALIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (23)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adult Medulloblastoma	Medulloblastoma	BEFREE	15994933, 20876797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	30389317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	GWASCAT_DG	29059683		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	2154410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	39566392	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	15994933, 20876797		★★★★★ ★☆☆☆☆ Found in Text Mining only
CILIARY DYSKINESIA, PRIMARY, 7 (disorder)	Ciliary Dyskinesia	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Ciliary Motility Disorders	Ciliary dyskinesia	CLINVAR_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cyclocephaly	Cyclocephaly	BEFREE	28789611		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	31173217		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	31173217		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	30389317, 31173217		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24141559		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	30042175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	15994933, 20876797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia Type 1	Multiple Endocrine Neoplasia	BEFREE	30620390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	GWASDB_DG	22120009, 23955597		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	27882933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	27882933, 35013207	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	27174688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	24141559, 30389317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	30042175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	37968767	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

CDCA7L (cell division cycle associated 7 like)