Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	55534
Gene name	Mastermind like transcriptional coactivator 3
Gene symbol	MAML3
Synonyms (NCBI Gene)	CAGH3ERDA3GDNMAM-2MAM2TNRC3mam-3
Chromosome	4
Chromosome location	4q31.1

234

Show/Hide all (234)

miRTarBase ID	miRNA	Experiments	Reference
MIRT508437	hsa-miR-1255b-2-3p	PAR-CLIP	20371350
MIRT508436	hsa-miR-1272	PAR-CLIP	20371350
MIRT508435	hsa-miR-1273g-3p	PAR-CLIP	20371350
MIRT508434	hsa-miR-4679	PAR-CLIP	20371350
MIRT508433	hsa-miR-4424	PAR-CLIP	20371350
MIRT508432	hsa-miR-3682-3p	PAR-CLIP	20371350
MIRT508437	hsa-miR-1255b-2-3p	PAR-CLIP	20371350
MIRT508436	hsa-miR-1272	PAR-CLIP	20371350
MIRT508435	hsa-miR-1273g-3p	PAR-CLIP	20371350
MIRT508434	hsa-miR-4679	PAR-CLIP	20371350
MIRT508433	hsa-miR-4424	PAR-CLIP	20371350
MIRT508432	hsa-miR-3682-3p	PAR-CLIP	20371350
MIRT547539	hsa-miR-144-3p	PAR-CLIP	21572407
MIRT547538	hsa-miR-101-3p	PAR-CLIP	21572407
MIRT547538	hsa-miR-101-3p	PAR-CLIP	21572407
MIRT547537	hsa-miR-485-3p	PAR-CLIP	21572407
MIRT547536	hsa-miR-539-3p	PAR-CLIP	21572407
MIRT547535	hsa-miR-576-3p	PAR-CLIP	21572407
MIRT547534	hsa-miR-452-3p	PAR-CLIP	21572407
MIRT547538	hsa-miR-101-3p	PAR-CLIP	21572407
MIRT547539	hsa-miR-144-3p	PAR-CLIP	21572407
MIRT547538	hsa-miR-101-3p	PAR-CLIP	21572407
MIRT547537	hsa-miR-485-3p	PAR-CLIP	21572407
MIRT547536	hsa-miR-539-3p	PAR-CLIP	21572407
MIRT547535	hsa-miR-576-3p	PAR-CLIP	21572407
MIRT547534	hsa-miR-452-3p	PAR-CLIP	21572407
MIRT536193	hsa-miR-548c-3p	PAR-CLIP	22012620
MIRT536192	hsa-miR-651-3p	PAR-CLIP	22012620
MIRT508437	hsa-miR-1255b-2-3p	PAR-CLIP	22012620
MIRT536191	hsa-miR-5684	PAR-CLIP	22012620
MIRT508436	hsa-miR-1272	PAR-CLIP	22012620
MIRT508435	hsa-miR-1273g-3p	PAR-CLIP	22012620
MIRT508434	hsa-miR-4679	PAR-CLIP	22012620
MIRT508433	hsa-miR-4424	PAR-CLIP	22012620
MIRT508432	hsa-miR-3682-3p	PAR-CLIP	22012620
MIRT536190	hsa-miR-4477b	PAR-CLIP	22012620
MIRT508437	hsa-miR-1255b-2-3p	PAR-CLIP	23446348
MIRT508436	hsa-miR-1272	PAR-CLIP	23446348
MIRT508435	hsa-miR-1273g-3p	PAR-CLIP	23446348
MIRT508434	hsa-miR-4679	PAR-CLIP	23446348
MIRT508433	hsa-miR-4424	PAR-CLIP	23446348
MIRT508432	hsa-miR-3682-3p	PAR-CLIP	23446348
MIRT508437	hsa-miR-1255b-2-3p	PAR-CLIP	20371350
MIRT508436	hsa-miR-1272	PAR-CLIP	20371350
MIRT508435	hsa-miR-1273g-3p	PAR-CLIP	20371350
MIRT508434	hsa-miR-4679	PAR-CLIP	20371350
MIRT508433	hsa-miR-4424	PAR-CLIP	20371350
MIRT508432	hsa-miR-3682-3p	PAR-CLIP	20371350
MIRT508437	hsa-miR-1255b-2-3p	PAR-CLIP	20371350
MIRT508436	hsa-miR-1272	PAR-CLIP	20371350
MIRT508435	hsa-miR-1273g-3p	PAR-CLIP	20371350
MIRT508434	hsa-miR-4679	PAR-CLIP	20371350
MIRT508433	hsa-miR-4424	PAR-CLIP	20371350
MIRT508432	hsa-miR-3682-3p	PAR-CLIP	20371350
MIRT547539	hsa-miR-144-3p	PAR-CLIP	21572407
MIRT547538	hsa-miR-101-3p	PAR-CLIP	21572407
MIRT547538	hsa-miR-101-3p	PAR-CLIP	21572407
MIRT547537	hsa-miR-485-3p	PAR-CLIP	21572407
MIRT547536	hsa-miR-539-3p	PAR-CLIP	21572407
MIRT547535	hsa-miR-576-3p	PAR-CLIP	21572407
MIRT547534	hsa-miR-452-3p	PAR-CLIP	21572407
MIRT547538	hsa-miR-101-3p	PAR-CLIP	21572407
MIRT547539	hsa-miR-144-3p	PAR-CLIP	21572407
MIRT547538	hsa-miR-101-3p	PAR-CLIP	21572407
MIRT547537	hsa-miR-485-3p	PAR-CLIP	21572407
MIRT547536	hsa-miR-539-3p	PAR-CLIP	21572407
MIRT547535	hsa-miR-576-3p	PAR-CLIP	21572407
MIRT547534	hsa-miR-452-3p	PAR-CLIP	21572407
MIRT536193	hsa-miR-548c-3p	PAR-CLIP	22012620
MIRT536192	hsa-miR-651-3p	PAR-CLIP	22012620
MIRT508437	hsa-miR-1255b-2-3p	PAR-CLIP	22012620
MIRT536191	hsa-miR-5684	PAR-CLIP	22012620
MIRT508436	hsa-miR-1272	PAR-CLIP	22012620
MIRT508435	hsa-miR-1273g-3p	PAR-CLIP	22012620
MIRT508434	hsa-miR-4679	PAR-CLIP	22012620
MIRT508433	hsa-miR-4424	PAR-CLIP	22012620
MIRT508432	hsa-miR-3682-3p	PAR-CLIP	22012620
MIRT536190	hsa-miR-4477b	PAR-CLIP	22012620
MIRT508437	hsa-miR-1255b-2-3p	PAR-CLIP	23446348
MIRT508436	hsa-miR-1272	PAR-CLIP	23446348
MIRT508435	hsa-miR-1273g-3p	PAR-CLIP	23446348
MIRT508434	hsa-miR-4679	PAR-CLIP	23446348
MIRT508433	hsa-miR-4424	PAR-CLIP	23446348
MIRT508432	hsa-miR-3682-3p	PAR-CLIP	23446348
MIRT1126939	hsa-miR-101	CLIP-seq
MIRT1126940	hsa-miR-1202	CLIP-seq
MIRT1126941	hsa-miR-1224-3p	CLIP-seq
MIRT1126942	hsa-miR-1288	CLIP-seq
MIRT1126943	hsa-miR-144	CLIP-seq
MIRT1126944	hsa-miR-18a	CLIP-seq
MIRT1126945	hsa-miR-18b	CLIP-seq
MIRT1126946	hsa-miR-1976	CLIP-seq
MIRT1126947	hsa-miR-2392	CLIP-seq
MIRT1126948	hsa-miR-302f	CLIP-seq
MIRT1126949	hsa-miR-3126-5p	CLIP-seq
MIRT1126950	hsa-miR-3140-3p	CLIP-seq
MIRT1126951	hsa-miR-3199	CLIP-seq
MIRT1126952	hsa-miR-370	CLIP-seq
MIRT1126953	hsa-miR-3944-5p	CLIP-seq
MIRT1126954	hsa-miR-3972	CLIP-seq
MIRT1126955	hsa-miR-4254	CLIP-seq
MIRT1126956	hsa-miR-4257	CLIP-seq
MIRT1126957	hsa-miR-4293	CLIP-seq
MIRT1126958	hsa-miR-4443	CLIP-seq
MIRT1126959	hsa-miR-4640-5p	CLIP-seq
MIRT1126960	hsa-miR-4641	CLIP-seq
MIRT1126961	hsa-miR-4645-5p	CLIP-seq
MIRT1126962	hsa-miR-4660	CLIP-seq
MIRT1126963	hsa-miR-4673	CLIP-seq
MIRT1126964	hsa-miR-4715-3p	CLIP-seq
MIRT1126965	hsa-miR-4726-5p	CLIP-seq
MIRT1126966	hsa-miR-4731-5p	CLIP-seq
MIRT1126967	hsa-miR-4733-3p	CLIP-seq
MIRT1126968	hsa-miR-4735-3p	CLIP-seq
MIRT1126969	hsa-miR-4755-3p	CLIP-seq
MIRT1126970	hsa-miR-4759	CLIP-seq
MIRT1126971	hsa-miR-4793-5p	CLIP-seq
MIRT1126972	hsa-miR-505	CLIP-seq
MIRT1126973	hsa-miR-548l	CLIP-seq
MIRT1126974	hsa-miR-619	CLIP-seq
MIRT1126975	hsa-miR-646	CLIP-seq
MIRT1126976	hsa-miR-7	CLIP-seq
MIRT1126977	hsa-miR-765	CLIP-seq
MIRT1126941	hsa-miR-1224-3p	CLIP-seq
MIRT1551022	hsa-miR-1226	CLIP-seq
MIRT1126942	hsa-miR-1288	CLIP-seq
MIRT1551023	hsa-miR-2467-3p	CLIP-seq
MIRT1126949	hsa-miR-3126-5p	CLIP-seq
MIRT1126951	hsa-miR-3199	CLIP-seq
MIRT1126955	hsa-miR-4254	CLIP-seq
MIRT1551024	hsa-miR-4530	CLIP-seq
MIRT1551025	hsa-miR-4688	CLIP-seq
MIRT1126964	hsa-miR-4715-3p	CLIP-seq
MIRT1126967	hsa-miR-4733-3p	CLIP-seq
MIRT1126974	hsa-miR-619	CLIP-seq
MIRT1551026	hsa-miR-634	CLIP-seq
MIRT1551027	hsa-miR-922	CLIP-seq
MIRT2035933	hsa-miR-1324	CLIP-seq
MIRT2035934	hsa-miR-1910	CLIP-seq
MIRT1126946	hsa-miR-1976	CLIP-seq
MIRT1551023	hsa-miR-2467-3p	CLIP-seq
MIRT2035935	hsa-miR-3183	CLIP-seq
MIRT2035936	hsa-miR-3615	CLIP-seq
MIRT1126952	hsa-miR-370	CLIP-seq
MIRT2035937	hsa-miR-3924	CLIP-seq
MIRT2035938	hsa-miR-4269	CLIP-seq
MIRT2035939	hsa-miR-4287	CLIP-seq
MIRT2035940	hsa-miR-4290	CLIP-seq
MIRT2035941	hsa-miR-4328	CLIP-seq
MIRT2035942	hsa-miR-4469	CLIP-seq
MIRT1126959	hsa-miR-4640-5p	CLIP-seq
MIRT1126961	hsa-miR-4645-5p	CLIP-seq
MIRT1126962	hsa-miR-4660	CLIP-seq
MIRT1126963	hsa-miR-4673	CLIP-seq
MIRT2035943	hsa-miR-4685-3p	CLIP-seq
MIRT2035944	hsa-miR-4691-5p	CLIP-seq
MIRT2035945	hsa-miR-4711-3p	CLIP-seq
MIRT1126964	hsa-miR-4715-3p	CLIP-seq
MIRT2035946	hsa-miR-4722-5p	CLIP-seq
MIRT2035947	hsa-miR-4723-3p	CLIP-seq
MIRT1126965	hsa-miR-4726-5p	CLIP-seq
MIRT1126966	hsa-miR-4731-5p	CLIP-seq
MIRT1126967	hsa-miR-4733-3p	CLIP-seq
MIRT1126969	hsa-miR-4755-3p	CLIP-seq
MIRT2035948	hsa-miR-4763-5p	CLIP-seq
MIRT2035949	hsa-miR-4768-3p	CLIP-seq
MIRT2035950	hsa-miR-486-3p	CLIP-seq
MIRT2035951	hsa-miR-486-5p	CLIP-seq
MIRT2035952	hsa-miR-579	CLIP-seq
MIRT2035953	hsa-miR-592	CLIP-seq
MIRT2035954	hsa-miR-599	CLIP-seq
MIRT2035955	hsa-miR-642a	CLIP-seq
MIRT1126975	hsa-miR-646	CLIP-seq
MIRT2035956	hsa-miR-942	CLIP-seq
MIRT2266310	hsa-miR-145	CLIP-seq
MIRT1126944	hsa-miR-18a	CLIP-seq
MIRT1126945	hsa-miR-18b	CLIP-seq
MIRT1126946	hsa-miR-1976	CLIP-seq
MIRT1126948	hsa-miR-302f	CLIP-seq
MIRT2266311	hsa-miR-3065-3p	CLIP-seq
MIRT2266312	hsa-miR-3691-5p	CLIP-seq
MIRT1126952	hsa-miR-370	CLIP-seq
MIRT2035941	hsa-miR-4328	CLIP-seq
MIRT1126959	hsa-miR-4640-5p	CLIP-seq
MIRT1126962	hsa-miR-4660	CLIP-seq
MIRT1126965	hsa-miR-4726-5p	CLIP-seq
MIRT1126966	hsa-miR-4731-5p	CLIP-seq
MIRT1126968	hsa-miR-4735-3p	CLIP-seq
MIRT2266313	hsa-miR-4752	CLIP-seq
MIRT1126969	hsa-miR-4755-3p	CLIP-seq
MIRT2266314	hsa-miR-499-3p	CLIP-seq
MIRT2266315	hsa-miR-548ac	CLIP-seq
MIRT2266316	hsa-miR-548ae	CLIP-seq
MIRT2266317	hsa-miR-548aj	CLIP-seq
MIRT2266318	hsa-miR-548am	CLIP-seq
MIRT2266319	hsa-miR-548d-3p	CLIP-seq
MIRT2266320	hsa-miR-548x	CLIP-seq
MIRT2266321	hsa-miR-548z	CLIP-seq
MIRT2266322	hsa-miR-640	CLIP-seq
MIRT1126975	hsa-miR-646	CLIP-seq
MIRT1126946	hsa-miR-1976	CLIP-seq
MIRT1126952	hsa-miR-370	CLIP-seq
MIRT1126959	hsa-miR-4640-5p	CLIP-seq
MIRT1126962	hsa-miR-4660	CLIP-seq
MIRT1126965	hsa-miR-4726-5p	CLIP-seq
MIRT1126966	hsa-miR-4731-5p	CLIP-seq
MIRT1126969	hsa-miR-4755-3p	CLIP-seq
MIRT1126975	hsa-miR-646	CLIP-seq
MIRT1126947	hsa-miR-2392	CLIP-seq
MIRT2453639	hsa-miR-3613-3p	CLIP-seq
MIRT2565471	hsa-miR-1229	CLIP-seq
MIRT2565472	hsa-miR-1254	CLIP-seq
MIRT2565473	hsa-miR-1913	CLIP-seq
MIRT1126947	hsa-miR-2392	CLIP-seq
MIRT2565474	hsa-miR-3116	CLIP-seq
MIRT2565475	hsa-miR-3127-3p	CLIP-seq
MIRT2565476	hsa-miR-3176	CLIP-seq
MIRT2565477	hsa-miR-324-3p	CLIP-seq
MIRT2453639	hsa-miR-3613-3p	CLIP-seq
MIRT2565478	hsa-miR-3667-3p	CLIP-seq
MIRT2565479	hsa-miR-378g	CLIP-seq
MIRT2565480	hsa-miR-3922-3p	CLIP-seq
MIRT2035938	hsa-miR-4269	CLIP-seq
MIRT1126961	hsa-miR-4645-5p	CLIP-seq
MIRT1126963	hsa-miR-4673	CLIP-seq
MIRT1126964	hsa-miR-4715-3p	CLIP-seq
MIRT2565481	hsa-miR-4722-3p	CLIP-seq
MIRT1126967	hsa-miR-4733-3p	CLIP-seq
MIRT2565482	hsa-miR-4749-3p	CLIP-seq
MIRT1126971	hsa-miR-4793-5p	CLIP-seq
MIRT2565483	hsa-miR-661	CLIP-seq
MIRT1126947	hsa-miR-2392	CLIP-seq
MIRT2453639	hsa-miR-3613-3p	CLIP-seq
MIRT1126972	hsa-miR-505	CLIP-seq

Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003713	Function	Transcription coactivator activity	IBA
GO:0003713	Function	Transcription coactivator activity	IDA	12370315
GO:0003713	Function	Transcription coactivator activity	IEA
GO:0005515	Function	Protein binding	IPI	12370315
GO:0005634	Component	Nucleus	IDA	12370315
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IBA
GO:0005654	Component	Nucleoplasm	TAS
GO:0007219	Process	Notch signaling pathway	IDA	12370315
GO:0007219	Process	Notch signaling pathway	IEA
GO:0007221	Process	Positive regulation of transcription of Notch receptor target	IBA
GO:0007221	Process	Positive regulation of transcription of Notch receptor target	IEA
GO:0016607	Component	Nuclear speck	IDA
GO:0016607	Component	Nuclear speck	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	12370315
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA

MIM	HGNC	e!Ensembl
608991	16272	ENSG00000196782

Q96JK9

Protein name

Mastermind-like protein 3 (Mam-3)

Protein function

Acts as a transcriptional coactivator for NOTCH proteins. Has been shown to amplify NOTCH-induced transcription of HES1.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF09596	MamL-1	68 → 125	MamL-1 domain	Domain

Sequence

MGDFAAPAAAANGSSICINSSLNSSLGGAGIGVNNTPNSTPAAPSSNHPAAGGCGGSGGP
GGGSAAVPKHSTVVERLRQRIEGCRRHHVNCENRYQQAQVEQLELERRDTVSLYQRTLEQ
RAKKSGAGTGKQQHPSKPQQDAEAASAEQRNHTLIMLQETVKRKLEGARSPLNGDQQNGA
CDGNFSPTSKRIRKDISAGMEAINNLPSNMPLPSASPLHQLDLKPSLPLQNSGTHTPGLL
EDLSKNGRLPEIKLPVNGCSDLEDSFTILQSKDLKQEPLDDPTCIDTSETSLSNQNKLFS
DINLNDQEWQELIDELANTVPEDDIQDLFNEDFEEKKEPEFSQPATETPLSQESASVKSD
PSHSPFAHVSMGSPQARPSSSGPPFSTVSTATSLPSVASTPAAPNPASSPANCAVQSPQT
PNQAHTPGQAPPRPGNGYLLNPAAVTVAGSASGPVAVPSSDMSPAEQLKQMAAQQQQRAK
LMQQKQQQQQQQQQQQQQQQQQQQQQQQQQHSNQTSNWSPLGPPSSPYGAAFTAEKPNSP
MMYPQAFNNQNPIVPPMANNLQKTTMNNYLPQNHMNMINQQPNNLGTNSLNKQHNILTYG
NTKPLTHFNADLSQRMTPPVANPNKNPLMPYIQQQQQQQQQQQQQQQQQQPPPPQLQAPR
AHLSEDQKRLLLMKQKGVMNQPMAYAALPSHGQEQHPVGLPRTTGPMQSSVPPGSGGMVS
GASPAGPGFLGSQPQAAIMKQMLIDQRAQLIEQQKQQFLREQRQQQQQQQQQILAEQQLQ
QSHLPRQHLQPQRNPYPVQQVNQFQGSPQDIAAVRSQAALQSMRTSRLMAQNAGMMGIGP
SQNPGTMATAAAQSEMGLAPYSTTPTSQPGMYNMSTGMTQMLQHPNQSGMSITHNQAQGP
RQPASGQGVGMVSGFGQSMLVNSAITQQHPQMKGPVGQALPRPQAPPRLQSLMGTVQQGA
QSWQQRSLQGMPGRTSGELGPFNNGASYPLQAGQPRLTKQHFPQGLSQSVVDANTGTVRT
LNPAAMGRQMMPSLPGQQGTSQARPMVMSGLSQGVPGMPAFSQPPAQQQIPSGSFAPSSQ
SQAYERNAPQDVSYNYSGDGAGGSFPGLPDGADLVDSIIKGGPGDEWMQELDELFGNP

Sequence length

1138

Interactions

View interactions

	KEGG		Reactome
	Notch signaling pathway Th1 and Th2 cell differentiation Human papillomavirus infection		Pre-NOTCH Transcription and Translation NOTCH1 Intracellular Domain Regulates Transcription NOTCH2 intracellular domain regulates transcription Constitutive Signaling by NOTCH1 PEST Domain Mutants Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants Notch-HLH transcription pathway RUNX3 regulates NOTCH signaling NOTCH3 Intracellular Domain Regulates Transcription NOTCH4 Intracellular Domain Regulates Transcription

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (35)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILE DUCT DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANNABIS DEPENDENCE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, ADENOID CYSTIC	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLESTASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL HEART DEFECTS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL HEART MALFORMATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DRY EYE SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART DEFECTS, CONGENITAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PEPTIC ULCER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SARCOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (64)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenoid Cystic Carcinoma	Adenocarcinoma	CTD_human_DG	23685749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	31234811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	27709636		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	27709636	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	GWASCAT_DG	27790247		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial fibrillation	Pubtator	33834070	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchial Hyperreactivity	Bronchial Hyperreactivity	BEFREE	27709636		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	33986121	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	29734873	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	33860048	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Hypertrophic, Familial	Cardiomyopathy	BEFREE	25234806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	GWASCAT_DG	27790247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	25234806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Clear cell sarcoma of kidney	Sarcoma Of Kidney	BEFREE	27428733		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	CTD_human_DG	23708190		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital Heart Defects	Congenital heart defects	GWASDB_DG	23708190		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital Heart Defects	Congenital heart defects	GWASCAT_DG	23708190		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL HEART DEFECTS, MULTIPLE TYPES, 1, X-LINKED	Congenital heart defects	GWASCAT_DG	23708190		★★★★★ ★☆☆☆☆ Found in Text Mining only
CONGENITAL HEART DEFECTS, MULTIPLE TYPES, 1, X-LINKED	Congenital heart defects	GWASDB_DG	23708190		★★★★★ ★☆☆☆☆ Found in Text Mining only
CONGENITAL HEART DEFECTS, MULTIPLE TYPES, 2	Congenital heart defects	GWASDB_DG	23708190		★★★★★ ★☆☆☆☆ Found in Text Mining only
CONGENITAL HEART DEFECTS, MULTIPLE TYPES, 2	Congenital heart defects	GWASCAT_DG	23708190		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital malformation of cardiac chambers and connections, unspecified	Congenital Malformation Of Cardiac Chambers And Connections	GWASCAT_DG	23708190		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital malformation of cardiac chambers and connections, unspecified	Congenital Malformation Of Cardiac Chambers And Connections	GWASDB_DG	23708190		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	GWASCAT_DG	27790247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Desmoplastic Small Round Cell Tumor	Desmoplastic small round cell tumor	Pubtator	26752546, 27428733	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	GWASCAT_DG	27790247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	GWASCAT_DG	27790247		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	27738313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	27738313	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	26752546, 29300189		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	37351966	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	GWASCAT_DG	31527586		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart failure	Heart Failure	GWASCAT_DG	27790247		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HETEROTAXY, VISCERAL, 1, X-LINKED	Heterotaxy, Visceral, X-Linked	GWASCAT_DG	23708190		★★★★★ ★☆☆☆☆ Found in Text Mining only
HETEROTAXY, VISCERAL, 1, X-LINKED	Heterotaxy, Visceral, X-Linked	GWASDB_DG	23708190		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	37351966	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	37351966	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	27738313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	30061220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28512191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26785999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	GWASCAT_DG	27790247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	10735498	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	26655998, 27738313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	26785999	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	31234811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	30061220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	BEFREE	31234811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	Pubtator	36083250	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	Pubtator	28162975, 33986121, 39218714	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	31234811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	36719455	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	31502214	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	24859338		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Sarcoma	CTD_human_DG	24859338		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Sarcoma	Pubtator	26752546, 32871837	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma Ewing	Sarcoma	Pubtator	26752546	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	26752546	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma, Epithelioid	Sarcoma	CTD_human_DG	24859338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma, Spindle Cell	Sarcoma	CTD_human_DG	24859338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	GWASCAT_DG	31374203		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sinonasal undifferentiated carcinoma	Sinonasal undifferentiated carcinoma	CTD_human_DG	24859338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	30061220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28512191		★★★★★ ★☆☆☆☆ Found in Text Mining only

MAML3 (mastermind like transcriptional coactivator 3)