Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	55532
Gene name	Solute carrier family 30 member 10
Gene symbol	SLC30A10
Synonyms (NCBI Gene)	HMDPCHMNDYT1ZNT10ZNT8ZRC1ZnT-10
Chromosome	1
Chromosome location	1q41
Summary	This gene is highly expressed in the liver and is inducible by manganese. Its protein product appears to be critical in maintaining manganese levels, and has higher specificity for manganese than zinc. Loss of function mutations appear to result in a pleo

Show/Hide all (5)

SNP ID	Visualize variation	Clinical significance	Consequence
rs281860289	CAC>-	Pathogenic	Non coding transcript variant, inframe deletion, coding sequence variant
rs281860290	G>A	Pathogenic	Non coding transcript variant, coding sequence variant, stop gained
rs281860291	A>G	Pathogenic	Non coding transcript variant, missense variant, coding sequence variant
rs281860292	T>-	Pathogenic	Non coding transcript variant, coding sequence variant, frameshift variant
rs770740586	G>A	Pathogenic	Non coding transcript variant, missense variant, coding sequence variant

110

Show/Hide all (110)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030334	hsa-miR-26b-5p	Microarray	19088304
MIRT717620	hsa-miR-3189-3p	HITS-CLIP	19536157
MIRT717619	hsa-miR-635	HITS-CLIP	19536157
MIRT717618	hsa-miR-6774-5p	HITS-CLIP	19536157
MIRT717617	hsa-miR-4424	HITS-CLIP	19536157
MIRT717616	hsa-miR-3945	HITS-CLIP	19536157
MIRT717615	hsa-miR-4253	HITS-CLIP	19536157
MIRT717614	hsa-miR-6862-5p	HITS-CLIP	19536157
MIRT717613	hsa-miR-335-3p	HITS-CLIP	19536157
MIRT639442	hsa-miR-455-3p	HITS-CLIP	23824327
MIRT639441	hsa-miR-6516-5p	HITS-CLIP	23824327
MIRT639440	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT639439	hsa-miR-507	HITS-CLIP	23824327
MIRT639438	hsa-miR-557	HITS-CLIP	23824327
MIRT639437	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT639436	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT446086	hsa-miR-4724-5p	PAR-CLIP	22100165
MIRT446087	hsa-miR-5584-3p	PAR-CLIP	22100165
MIRT446085	hsa-miR-4539	PAR-CLIP	22100165
MIRT446084	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT446083	hsa-miR-1303	PAR-CLIP	22100165
MIRT446086	hsa-miR-4724-5p	PAR-CLIP	22100165
MIRT446087	hsa-miR-5584-3p	PAR-CLIP	22100165
MIRT446085	hsa-miR-4539	PAR-CLIP	22100165
MIRT446084	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT446083	hsa-miR-1303	PAR-CLIP	22100165
MIRT639442	hsa-miR-455-3p	PAR-CLIP	27292025
MIRT639441	hsa-miR-6516-5p	PAR-CLIP	27292025
MIRT717620	hsa-miR-3189-3p	HITS-CLIP	19536157
MIRT717619	hsa-miR-635	HITS-CLIP	19536157
MIRT717618	hsa-miR-6774-5p	HITS-CLIP	19536157
MIRT717617	hsa-miR-4424	HITS-CLIP	19536157
MIRT717616	hsa-miR-3945	HITS-CLIP	19536157
MIRT717615	hsa-miR-4253	HITS-CLIP	19536157
MIRT717614	hsa-miR-6862-5p	HITS-CLIP	19536157
MIRT717613	hsa-miR-335-3p	HITS-CLIP	19536157
MIRT639442	hsa-miR-455-3p	HITS-CLIP	23824327
MIRT639441	hsa-miR-6516-5p	HITS-CLIP	23824327
MIRT639440	hsa-miR-450b-5p	HITS-CLIP	23824327
MIRT639439	hsa-miR-507	HITS-CLIP	23824327
MIRT639438	hsa-miR-557	HITS-CLIP	23824327
MIRT639437	hsa-miR-3680-3p	HITS-CLIP	23824327
MIRT639436	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT446086	hsa-miR-4724-5p	PAR-CLIP	22100165
MIRT446087	hsa-miR-5584-3p	PAR-CLIP	22100165
MIRT446085	hsa-miR-4539	PAR-CLIP	22100165
MIRT446084	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT446083	hsa-miR-1303	PAR-CLIP	22100165
MIRT446086	hsa-miR-4724-5p	PAR-CLIP	22100165
MIRT446087	hsa-miR-5584-3p	PAR-CLIP	22100165
MIRT446085	hsa-miR-4539	PAR-CLIP	22100165
MIRT446084	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT446083	hsa-miR-1303	PAR-CLIP	22100165
MIRT1359057	hsa-miR-103a	CLIP-seq
MIRT1359058	hsa-miR-107	CLIP-seq
MIRT1359059	hsa-miR-1276	CLIP-seq
MIRT1359060	hsa-miR-132	CLIP-seq
MIRT1359061	hsa-miR-148a	CLIP-seq
MIRT1359062	hsa-miR-148b	CLIP-seq
MIRT1359063	hsa-miR-152	CLIP-seq
MIRT1359064	hsa-miR-15a	CLIP-seq
MIRT1359065	hsa-miR-15b	CLIP-seq
MIRT1359066	hsa-miR-16	CLIP-seq
MIRT1359067	hsa-miR-195	CLIP-seq
MIRT1359068	hsa-miR-21	CLIP-seq
MIRT1359069	hsa-miR-212	CLIP-seq
MIRT1359070	hsa-miR-2278	CLIP-seq
MIRT1359071	hsa-miR-2682	CLIP-seq
MIRT1359072	hsa-miR-3145-3p	CLIP-seq
MIRT1359073	hsa-miR-3714	CLIP-seq
MIRT1359074	hsa-miR-424	CLIP-seq
MIRT1359075	hsa-miR-4276	CLIP-seq
MIRT1359076	hsa-miR-4311	CLIP-seq
MIRT1359077	hsa-miR-449c	CLIP-seq
MIRT1359078	hsa-miR-4659a-3p	CLIP-seq
MIRT1359079	hsa-miR-4659b-3p	CLIP-seq
MIRT1359080	hsa-miR-494	CLIP-seq
MIRT1359081	hsa-miR-497	CLIP-seq
MIRT1359082	hsa-miR-583	CLIP-seq
MIRT1359083	hsa-miR-590-5p	CLIP-seq
MIRT1922379	hsa-miR-3613-3p	CLIP-seq
MIRT1922380	hsa-miR-3646	CLIP-seq
MIRT1922381	hsa-miR-3662	CLIP-seq
MIRT1922382	hsa-miR-4272	CLIP-seq
MIRT2330608	hsa-miR-1229	CLIP-seq
MIRT2330609	hsa-miR-27a	CLIP-seq
MIRT2330610	hsa-miR-27b	CLIP-seq
MIRT2330611	hsa-miR-30a	CLIP-seq
MIRT2330612	hsa-miR-30b	CLIP-seq
MIRT2330613	hsa-miR-30c	CLIP-seq
MIRT2330614	hsa-miR-30d	CLIP-seq
MIRT2330615	hsa-miR-30e	CLIP-seq
MIRT2330616	hsa-miR-4277	CLIP-seq
MIRT2330617	hsa-miR-513a-5p	CLIP-seq
MIRT2330618	hsa-miR-548a-5p	CLIP-seq
MIRT2330619	hsa-miR-548ab	CLIP-seq
MIRT2330620	hsa-miR-548ak	CLIP-seq
MIRT2330621	hsa-miR-548b-5p	CLIP-seq
MIRT2330622	hsa-miR-548c-5p	CLIP-seq
MIRT2330623	hsa-miR-548d-5p	CLIP-seq
MIRT2330624	hsa-miR-548h	CLIP-seq
MIRT2330625	hsa-miR-548i	CLIP-seq
MIRT2330626	hsa-miR-548j	CLIP-seq
MIRT2330627	hsa-miR-548w	CLIP-seq
MIRT2330628	hsa-miR-548y	CLIP-seq
MIRT2330629	hsa-miR-559	CLIP-seq
MIRT2330630	hsa-miR-922	CLIP-seq
MIRT2624682	hsa-miR-4496	CLIP-seq
MIRT2624683	hsa-miR-4738-3p	CLIP-seq
MIRT2624684	hsa-miR-873	CLIP-seq

Show/Hide all (49)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0005384	Function	Manganese ion transmembrane transporter activity	IDA	25319704
GO:0005384	Function	Manganese ion transmembrane transporter activity	IMP	27226609, 27307044
GO:0005384	Function	Manganese ion transmembrane transporter activity	TAS
GO:0005385	Function	Zinc ion transmembrane transporter activity	IBA
GO:0005385	Function	Zinc ion transmembrane transporter activity	IDA	30755481
GO:0005385	Function	Zinc ion transmembrane transporter activity	IDA	22427991, 26728129
GO:0005515	Function	Protein binding	IPI	26728129
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	IDA	26728129
GO:0005794	Component	Golgi apparatus	IDA	22706290, 27226609
GO:0005794	Component	Golgi apparatus	IEA
GO:0005886	Component	Plasma membrane	IDA	25319704, 27226609, 27307044
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006812	Process	Monoatomic cation transport	IEA
GO:0006828	Process	Manganese ion transport	IBA
GO:0006828	Process	Manganese ion transport	IMP	22341972, 26728129
GO:0006829	Process	Zinc ion transport	IEA
GO:0006878	Process	Intracellular copper ion homeostasis	IDA	25319704
GO:0006882	Process	Intracellular zinc ion homeostasis	IBA
GO:0006882	Process	Intracellular zinc ion homeostasis	IDA	25319704
GO:0006882	Process	Intracellular zinc ion homeostasis	IDA	22427991, 26728129
GO:0006882	Process	Intracellular zinc ion homeostasis	IMP	27226609
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IDA	26728129
GO:0008021	Component	Synaptic vesicle	IDA	26728129
GO:0008324	Function	Monoatomic cation transmembrane transporter activity	IEA
GO:0010312	Process	Detoxification of zinc ion	IBA
GO:0015297	Function	Antiporter activity	IEA
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0030026	Process	Intracellular manganese ion homeostasis	IDA	25319704
GO:0030026	Process	Intracellular manganese ion homeostasis	IMP	22341972, 27226609, 27307044
GO:0031901	Component	Early endosome membrane	IDA	22427991
GO:0031901	Component	Early endosome membrane	IEA
GO:0055037	Component	Recycling endosome	IDA	26728129
GO:0055038	Component	Recycling endosome membrane	IDA	22427991
GO:0055038	Component	Recycling endosome membrane	IEA
GO:0055071	Process	Manganese ion homeostasis	IEA
GO:0055085	Process	Transmembrane transport	IEA
GO:0062111	Process	Zinc ion import into organelle	IDA	22427991
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	26728129
GO:0071577	Process	Zinc ion transmembrane transport	IBA
GO:0071577	Process	Zinc ion transmembrane transport	IEA
GO:0140048	Process	Manganese ion export across plasma membrane	IDA	25319704
GO:0140048	Process	Manganese ion export across plasma membrane	IMP	27307044
GO:0140983	Function	Calcium:manganese antiporter activity	IDA	30755481
GO:1904385	Process	Cellular response to angiotensin	IDA	22427991

MIM	HGNC	e!Ensembl
611146	25355	ENSG00000196660

Q6XR72

Protein name

Calcium/manganese antiporter SLC30A10 (Solute carrier family 30 member 10) (Zinc transporter 10) (ZnT-10)

Protein function

Calcium:manganese antiporter of the plasma membrane mediating the efflux of intracellular manganese coupled to an active extracellular calcium exchange (PubMed:30755481). Required for intracellular manganese homeostasis, an essential cation for

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01545	Cation_efflux	11 → 307	Cation efflux family	Family

Tissue specificity

TISSUE SPECIFICITY: Specifically expressed in fetal liver and fetal brain (PubMed:15154973). Expressed in adult tissues with relative levels small intestine > liver > testes > brain > ovary > colon > cervix > prostate > placenta (PubMed:22706290). Express

Sequence

MGRYSGKTCRLLFMLVLTVAFFVAELVSGYLGNSIALLSDSFNMLSDLISLCVGLSAGYI
ARRPTRGFSATYGYARAEVVGALSNAVFLTALCFTIFVEAVLRLARPERIDDPELVLIVG
VLGLLVNVVGLLIFQDCAAWFACCLRGRSRRLQQRQQLAEGCVPGAFGGPQGAEDPRRAA
DPTAPGSDSAVTLRGTSVERKREKGATVFANVAGDSFNTQNEPEDMMKKEKKSEALNIRG
VLLHVMGDALGSVVVVITAIIFYVLPLKSEDPCNWQCYIDPSLTVLMVIIILSSAFPLIK
ETAAILLQMVPKGVNMEELMSKLSAVPGISSVHEVHIWELVSGKIIATLHIKYPKDRGYQ
DASTKIREIFHHAGIHNVTIQFENVDLKEPLEQKDLLLLCNSPCISKGCAKQLCCPPGAL
PLAHVNGCAEHNGGPSLDTYGSDGLSRRDAREVAIEVSLDSCLSDHGQSLNKTQEDQCYV
NRTHF

Sequence length

485

Interactions

View interactions

	Reactome
			Metal ion SLC transporters

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Hypermanganesemia with dystonia, polycythemia, and cirrhosis	Likely pathogenic; Pathogenic	rs2527884093, rs281860285, rs281860284, rs281860288, rs281860287, rs281860292, rs281860290	RCV003480013 RCV000023870 RCV000023871 RCV000023872 RCV000023873 RCV000023874 RCV000031961 View all (2 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (22)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BLADDER CALCULUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLESTASIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CIRRHOSIS - DYSTONIA - POLYCYTHEMIA - HYPERMANGANESEMIA SYNDROME	—	GenCC	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CIRRHOSIS-DYSTONIA-POLYCYTHEMIA-HYPERMANGANESEMIA SYNDROME	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital Erythrocytosis	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSTONIA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSTONIA DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROLITHIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSONIAN DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYTHEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SLC30A10-related disorder	Likely benign; Conflicting classifications of pathogenicity; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UROLITHIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (92)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Anemia Iron Deficiency	Iron deficiency anemia	Pubtator	34315874	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	27487045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	31233999	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	31233999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	18591387, 19590848, 19655390, 22526607, 23296174, 23861236, 27487045, 28358037, 28943512, 30783963, 31148332, 31444530		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autosomal Dominant Juvenile Parkinson Disease	Parkinson Disease	CTD_human_DG	26220508		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autosomal Dominant Parkinsonism	Parkinsonian disease	CTD_human_DG	26220508		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autosomal Recessive Parkinsonism	Parkinsonian disease	CTD_human_DG	26220508		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bile Duct Neoplasms	Bile duct neoplasms	Pubtator	34315874	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32247823	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	27487045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Central hypothyroidism	Central hypothyroidism	CTD_human_DG	28860195		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	CTD_human_DG	27989131		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	GWASCAT_DG	30804561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis-dystonia-polycythemia-hypermanganesemia syndrome	Cirrhosis-Dystonia-Polycythemia-Hypermanganesemia Syndrome	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32071364, 32351322, 39596116	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32633358	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
CONGENITAL DISORDER OF GLYCOSYLATION, TYPE IIn	Congenital disorder of glycosylation	BEFREE	31089831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	29333637		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	18591387, 19095428, 19655390, 19808923, 21099260, 21138544, 21518407, 21708156, 22446173, 22526605, 22776074, 23061550, 23712485, 24675520, 24865615 View all (18 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	18591387, 19095428, 19655390, 19808923, 20351753, 21099260, 21138544, 21518407, 21708156, 22446173, 22526605, 22776074, 23061550, 23712485, 24675520 View all (20 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	31167208	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	18438525, 18591387, 18594270, 18850084, 19323954, 19450229, 19590848, 19655390, 19808923, 20836749, 21067978, 21244337, 21708156, 22069278, 22069281 View all (46 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Ketosis-Prone	Diabetes Mellitus	BEFREE	30327357		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	18324385, 18591387, 18594270, 19095428, 19450229, 19542200, 19808923, 20836749, 21099260, 21708156, 21798992, 22584884, 23194113, 24584071, 24819161 View all (21 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes, Autoimmune	Autoimmune Diabetes	BEFREE	19808923, 23061550, 29288641, 29327148		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Ketoacidosis	Diabetic Ketoacidosis	BEFREE	29327148, 30327357		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysarthria	Dysarthria	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dystonia	Dystonia	Pubtator	22341971, 22341972, 22926781	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dystonia Disorders	Dystonia	BEFREE	22926781, 23757263, 23775978, 31089831, 31288771		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dystonia, Primary	Dystonia	BEFREE	23775978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dystrophia myotonica 2	Myotonic dystrophy	BEFREE	18774338, 28845600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Varices	Esophageal varix	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Juvenile Parkinsonism	Parkinsonian disease	CTD_human_DG	26220508		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	CTD_human_DG	22926781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	25935328		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	23595627	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	30783963		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	29333637		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	22341971	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	33049985	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperbilirubinemia	Hyperbilirubinemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	23712485, 31220282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	19095428		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypermanganesemia with Dystonia Polycythemia and Cirrhosis	Hypermanganesemia with Dystonia Polycythemia and Cirrhosis	BEFREE	22341971, 27117033, 28692648, 29193034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypermanganesemia with Dystonia Polycythemia and Cirrhosis	Hypermanganesemia with Dystonia Polycythemia and Cirrhosis	UNIPROT_DG	22341971, 22341972, 25319704		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypermanganesemia with Dystonia Polycythemia and Cirrhosis	Hypermanganesemia with Dystonia Polycythemia and Cirrhosis	CTD_human_DG	22341971, 22926781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypermanganesemia with Dystonia Polycythemia and Cirrhosis	Hypermanganesemia with Dystonia Polycythemia and Cirrhosis	ORPHANET_DG	22341972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypermanganesemia with Dystonia Polycythemia and Cirrhosis	Hypermanganesemia with Dystonia Polycythemia and Cirrhosis	GENOMICS_ENGLAND_DG	22926781, 25778823, 27604308, 29179235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypermanganesemia with Dystonia Polycythemia and Cirrhosis	Hypermanganesemia with Dystonia Polycythemia and Cirrhosis	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	29431830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoaldosteronism	Hypoaldosteronism	BEFREE	26405073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	28860195		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypothyroidism	Hypothyroidism	CTD_human_DG	28860195		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
insulinoma	Insulinoma	BEFREE	20091020, 29064047, 30903759, 31591269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ketosis	Ketosis	BEFREE	26519333, 28943512, 29327148		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	22341972, 22926781	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis	Liver Cirrhosis	CTD_human_DG	22926781		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Diseases	Liver disease	Pubtator	22341971	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Maturity onset diabetes mellitus in young	Mason type diabetes	BEFREE	30377089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	32247823	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	28490771		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Micronodular cirrhosis	Micronodular cirrhosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
MUTYH-Associate Polyposis	Polyposis	BEFREE	28472070		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	BEFREE	22685421		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	31089831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	28688763		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	30936149, 31167208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	31167208	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paratuberculosis	Paratuberculosis	BEFREE	26923214, 27580332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	23357421, 27107558	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	CTD_human_DG	25149416		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE 2, AUTOSOMAL RECESSIVE JUVENILE	Parkinson Disease	CTD_human_DG	26220508		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease Secondary	Secondary parkinson disease	Pubtator	22341971, 23357421, 27107558, 27307044, 30272946	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	23357421, 25319704, 30272946		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinsonian Disorders	Parkinson Disease	CTD_human_DG	26220508		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinsonian Disorders	Parkinson disease	Pubtator	30272946	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinsonian Disorders	Parkinson Disease	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinsonism, Juvenile	Parkinsonian disease	CTD_human_DG	26220508		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia	Polycythemia	Pubtator	22341971, 22341972, 22926781	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycythemia	Polycythemia	CTD_human_DG	22926781		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycythemia	Polycythemia	BEFREE	31288771, 31527311		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polycythemia	Polycythemia	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Portal Hypertension	Portal Hypertension	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Hypothyroidism	Hypothyroidism	CTD_human_DG	28860195		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	27833104, 35049094	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ramsay Hunt Paralysis Syndrome	Ramsay Hunt Paralysis Syndrome	CTD_human_DG	26220508		★★★★★ ★☆☆☆☆ Found in Text Mining only
Secondary hypothyroidism	Hypothyroidism	CTD_human_DG	28860195		★★★★★ ★☆☆☆☆ Found in Text Mining only

SLC30A10 (solute carrier family 30 member 10)