Gene Gene information from NCBI Gene database.
Entrez ID 5553
Gene name Proteoglycan 2, pro eosinophil major basic protein
Gene symbol PRG2
Synonyms (NCBI Gene)
BMPGMBPMBP1proMBP
Chromosome 11
Chromosome location 11q12.1
Summary The protein encoded by this gene is the predominant constituent of the crystalline core of the eosinophil granule. High levels of the proform of this protein are also present in placenta and pregnancy serum, where it exists as a complex with several other
miRNA miRNA information provided by mirtarbase database.
7
miRTarBase ID miRNA Experiments Reference
MIRT1261261 hsa-miR-1827 CLIP-seq
MIRT1261262 hsa-miR-22 CLIP-seq
MIRT1261263 hsa-miR-3612 CLIP-seq
MIRT1261264 hsa-miR-4768-3p CLIP-seq
MIRT1261265 hsa-miR-4779 CLIP-seq
Transcription factors Transcription factors information provided by TRRUST V2 database.
4
Transcription factor Regulation Reference
CEBPE Repression 12202480
GATA1 Activation 10438731;12202480
GATA2 Repression 10438731;9558404
SPI1 Activation 12202480
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
20
GO ID Ontology Definition Evidence Reference
GO:0002215 Process Defense response to nematode IEA
GO:0002376 Process Immune system process IEA
GO:0005515 Function Protein binding IPI 7685339, 12421832
GO:0005576 Component Extracellular region IEA
GO:0005576 Component Extracellular region TAS 8547309
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
605601 9362 ENSG00000186652
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P13727
Protein name Bone marrow proteoglycan (BMPG) (Proteoglycan 2) [Cleaved into: Eosinophil granule major basic protein (EMBP) (MBP) (Pregnancy-associated major basic protein)]
Protein function Cytotoxin and helminthotoxin. Also induces non-cytolytic histamine release from human basophils. Involved in antiparasitic defense mechanisms and immune hypersensitivity reactions. The proform acts as a proteinase inhibitor, reducing the activit
PDB 1H8U , 2BRS , 4QXX , 7Y5N , 8HGG , 9DKZ
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00059 Lectin_C 114 222 Lectin C-type domain Domain
Tissue specificity TISSUE SPECIFICITY: Detected in plasma and urine (at protein level) (PubMed:25326458, PubMed:36213313, PubMed:37453717). Detected in placenta (at protein level) (PubMed:32337544). High levels of the proform in placenta and pregnancy serum; in placenta, lo
Sequence
MKLPLLLALLFGAVSALHLRSETSTFETPLGAKTLPEDEETPEQEMEETPCRELEEEEEW
GSGSEDASKKDGAVESISVPDMVDKNLTCPEEEDTVKVVGIPGCQTCRYLLVRSLQTFSQ
AWFTCRRCYRGNLVSIHNFNINYRIQCSVSALNQGQVWIGGRITGSGRCRRFQWVDGSRW
NFAYWAAHQPWSRGGHCVALCTRGGHWRRAHCLRRLPFICSY
Sequence length 222
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Asthma   Neutrophil degranulation
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
3
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ALZHEIMER DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
ABLEPHARON-MACROSTOMIA SYNDROME Ablepharon macrostomia syndrome BEFREE 18930441
★☆☆☆☆
Found in Text Mining only
Acute lymphocytic leukemia Lymphocytic Leukemia BEFREE 20438785
★☆☆☆☆
Found in Text Mining only
Adrenoleukodystrophy Adrenoleukodystrophy BEFREE 11525804
★☆☆☆☆
Found in Text Mining only
Adult Oligodendroglioma Oligodendroglioma BEFREE 12175864, 7504278
★☆☆☆☆
Found in Text Mining only
Alzheimer Disease Alzheimer disease Pubtator 19385666, 24586351 Associate
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Amnesia Amnesia BEFREE 29476728
★☆☆☆☆
Found in Text Mining only
Amyloidosis Amyloidosis BEFREE 22762559
★☆☆☆☆
Found in Text Mining only
Amyotrophic Lateral Sclerosis Amyotrophic Lateral Sclerosis BEFREE 29337119
★☆☆☆☆
Found in Text Mining only
Amyotrophic Lateral Sclerosis Amyotrophic lateral sclerosis Pubtator 29337119 Associate
★☆☆☆☆
Found in Text Mining only
Anemia Anemia BEFREE 30096541
★☆☆☆☆
Found in Text Mining only