SRGN (serglycin)

Gene

• Entrez ID: 5552
• Gene name: Serglycin
• Gene symbol: SRGN
• Synonyms (NCBI Gene): PPG, PRG, PRG1
• Chromosome: 10
• Chromosome location: 10q22.1
• Summary: This gene encodes a protein best known as a hematopoietic cell granule proteoglycan. Proteoglycans stored in the secretory granules of many hematopoietic cells also contain a protease-resistant peptide core, which may be important for neutralizing hydroly

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT028982	hsa-miR-26b-5p	Microarray	19088304
MIRT372958	hsa-miR-4761-5p	PAR-CLIP	23592263
MIRT372955	hsa-miR-4317	PAR-CLIP	23592263
MIRT372960	hsa-miR-7978	PAR-CLIP	23592263
MIRT372950	hsa-miR-1254	PAR-CLIP	23592263
MIRT372952	hsa-miR-3116	PAR-CLIP	23592263
MIRT372949	hsa-miR-661	PAR-CLIP	23592263
MIRT491418	hsa-miR-6894-3p	PAR-CLIP	23592263
MIRT491417	hsa-miR-6514-3p	PAR-CLIP	23592263
MIRT726459	hsa-miR-181a-5p	HITS-CLIP	22473208
MIRT726458	hsa-miR-181b-5p	HITS-CLIP	22473208
MIRT726457	hsa-miR-181c-5p	HITS-CLIP	22473208
MIRT726456	hsa-miR-181d-5p	HITS-CLIP	22473208
MIRT372958	hsa-miR-4761-5p	PAR-CLIP	23592263
MIRT372955	hsa-miR-4317	PAR-CLIP	23592263
MIRT372960	hsa-miR-7978	PAR-CLIP	23592263
MIRT372950	hsa-miR-1254	PAR-CLIP	23592263
MIRT372952	hsa-miR-3116	PAR-CLIP	23592263
MIRT372949	hsa-miR-661	PAR-CLIP	23592263
MIRT491418	hsa-miR-6894-3p	PAR-CLIP	23592263
MIRT491417	hsa-miR-6514-3p	PAR-CLIP	23592263
MIRT1388982	hsa-miR-1305	CLIP-seq
MIRT1388983	hsa-miR-181a	CLIP-seq
MIRT1388984	hsa-miR-181b	CLIP-seq
MIRT1388985	hsa-miR-181c	CLIP-seq
MIRT1388986	hsa-miR-181d	CLIP-seq
MIRT1388987	hsa-miR-3143	CLIP-seq
MIRT1388988	hsa-miR-3613-3p	CLIP-seq
MIRT1388989	hsa-miR-3647-3p	CLIP-seq
MIRT1388990	hsa-miR-3665	CLIP-seq
MIRT1388991	hsa-miR-4262	CLIP-seq
MIRT1388992	hsa-miR-4672	CLIP-seq
MIRT1388993	hsa-miR-4678	CLIP-seq
MIRT1388994	hsa-miR-498	CLIP-seq
MIRT1388995	hsa-miR-543	CLIP-seq
MIRT1388996	hsa-miR-548ag	CLIP-seq
MIRT1388997	hsa-miR-548ai	CLIP-seq
MIRT1388998	hsa-miR-548m	CLIP-seq
MIRT1388999	hsa-miR-633	CLIP-seq
MIRT1389000	hsa-miR-657	CLIP-seq
MIRT1389001	hsa-miR-802	CLIP-seq
MIRT1554154	hsa-miR-2277-3p	CLIP-seq
MIRT1554155	hsa-miR-4775	CLIP-seq
MIRT1554156	hsa-miR-892a	CLIP-seq
MIRT1557126	hsa-miR-1245b-3p	CLIP-seq
MIRT1557127	hsa-miR-3163	CLIP-seq
MIRT1557128	hsa-miR-3942-3p	CLIP-seq
MIRT1557129	hsa-miR-4282	CLIP-seq
MIRT1557130	hsa-miR-4310	CLIP-seq
MIRT1557131	hsa-miR-4422	CLIP-seq
MIRT1557132	hsa-miR-513a-3p	CLIP-seq
MIRT1557133	hsa-miR-548c-3p	CLIP-seq
MIRT2116610	hsa-miR-4528	CLIP-seq
MIRT2460545	hsa-miR-544	CLIP-seq
MIRT2460546	hsa-miR-889	CLIP-seq
MIRT2632548	hsa-miR-10a	CLIP-seq
MIRT2632549	hsa-miR-10b	CLIP-seq
MIRT2632550	hsa-miR-1208	CLIP-seq
MIRT2632551	hsa-miR-1283	CLIP-seq
MIRT1388982	hsa-miR-1305	CLIP-seq
MIRT1388983	hsa-miR-181a	CLIP-seq
MIRT1388984	hsa-miR-181b	CLIP-seq
MIRT1388985	hsa-miR-181c	CLIP-seq
MIRT1388986	hsa-miR-181d	CLIP-seq
MIRT2632552	hsa-miR-2276	CLIP-seq
MIRT2632553	hsa-miR-3121-3p	CLIP-seq
MIRT1557127	hsa-miR-3163	CLIP-seq
MIRT2632554	hsa-miR-3194-3p	CLIP-seq
MIRT2632555	hsa-miR-3607-3p	CLIP-seq
MIRT1388988	hsa-miR-3613-3p	CLIP-seq
MIRT2632556	hsa-miR-3620	CLIP-seq
MIRT2632557	hsa-miR-3653	CLIP-seq
MIRT2632558	hsa-miR-3658	CLIP-seq
MIRT1388990	hsa-miR-3665	CLIP-seq
MIRT2632559	hsa-miR-3671	CLIP-seq
MIRT1388991	hsa-miR-4262	CLIP-seq
MIRT2632560	hsa-miR-4286	CLIP-seq
MIRT1557130	hsa-miR-4310	CLIP-seq
MIRT2632561	hsa-miR-4420	CLIP-seq
MIRT1557131	hsa-miR-4422	CLIP-seq
MIRT2632562	hsa-miR-4640-3p	CLIP-seq
MIRT2632563	hsa-miR-4661-5p	CLIP-seq
MIRT1388993	hsa-miR-4678	CLIP-seq
MIRT2632564	hsa-miR-4760-3p	CLIP-seq
MIRT2632565	hsa-miR-4772-3p	CLIP-seq
MIRT1388994	hsa-miR-498	CLIP-seq
MIRT2632566	hsa-miR-500a	CLIP-seq
MIRT2632567	hsa-miR-501-5p	CLIP-seq
MIRT1388996	hsa-miR-548ag	CLIP-seq
MIRT1388997	hsa-miR-548ai	CLIP-seq
MIRT1388998	hsa-miR-548m	CLIP-seq
MIRT2632568	hsa-miR-577	CLIP-seq
MIRT1388999	hsa-miR-633	CLIP-seq
MIRT1389000	hsa-miR-657	CLIP-seq
MIRT1554156	hsa-miR-892a	CLIP-seq
MIRT2632548	hsa-miR-10a	CLIP-seq
MIRT2632549	hsa-miR-10b	CLIP-seq
MIRT2632550	hsa-miR-1208	CLIP-seq
MIRT2632551	hsa-miR-1283	CLIP-seq
MIRT1388982	hsa-miR-1305	CLIP-seq
MIRT1388983	hsa-miR-181a	CLIP-seq
MIRT1388984	hsa-miR-181b	CLIP-seq
MIRT1388985	hsa-miR-181c	CLIP-seq
MIRT1388986	hsa-miR-181d	CLIP-seq
MIRT2691969	hsa-miR-194	CLIP-seq
MIRT2632552	hsa-miR-2276	CLIP-seq
MIRT1554154	hsa-miR-2277-3p	CLIP-seq
MIRT2691970	hsa-miR-3120-3p	CLIP-seq
MIRT2632553	hsa-miR-3121-3p	CLIP-seq
MIRT2691971	hsa-miR-3122	CLIP-seq
MIRT1557127	hsa-miR-3163	CLIP-seq
MIRT2691972	hsa-miR-3170	CLIP-seq
MIRT2632554	hsa-miR-3194-3p	CLIP-seq
MIRT2691973	hsa-miR-342-5p	CLIP-seq
MIRT2632555	hsa-miR-3607-3p	CLIP-seq
MIRT1388988	hsa-miR-3613-3p	CLIP-seq
MIRT2632556	hsa-miR-3620	CLIP-seq
MIRT1388990	hsa-miR-3665	CLIP-seq
MIRT2632559	hsa-miR-3671	CLIP-seq
MIRT2691974	hsa-miR-3689a-3p	CLIP-seq
MIRT2691975	hsa-miR-3689c	CLIP-seq
MIRT2691976	hsa-miR-380	CLIP-seq
MIRT2691977	hsa-miR-3913-5p	CLIP-seq
MIRT2691978	hsa-miR-3924	CLIP-seq
MIRT2691979	hsa-miR-4260	CLIP-seq
MIRT1388991	hsa-miR-4262	CLIP-seq
MIRT2632560	hsa-miR-4286	CLIP-seq
MIRT1557130	hsa-miR-4310	CLIP-seq
MIRT2632561	hsa-miR-4420	CLIP-seq
MIRT1557131	hsa-miR-4422	CLIP-seq
MIRT2691980	hsa-miR-4424	CLIP-seq
MIRT2691981	hsa-miR-4495	CLIP-seq
MIRT2632562	hsa-miR-4640-3p	CLIP-seq
MIRT2691982	hsa-miR-4651	CLIP-seq
MIRT2691983	hsa-miR-4653-3p	CLIP-seq
MIRT2632563	hsa-miR-4661-5p	CLIP-seq
MIRT2691984	hsa-miR-4664-5p	CLIP-seq
MIRT1388993	hsa-miR-4678	CLIP-seq
MIRT2691985	hsa-miR-4694-5p	CLIP-seq
MIRT2632565	hsa-miR-4772-3p	CLIP-seq
MIRT1554155	hsa-miR-4775	CLIP-seq
MIRT1388994	hsa-miR-498	CLIP-seq
MIRT2632566	hsa-miR-500a	CLIP-seq
MIRT2632567	hsa-miR-501-5p	CLIP-seq
MIRT1388996	hsa-miR-548ag	CLIP-seq
MIRT1388997	hsa-miR-548ai	CLIP-seq
MIRT1388998	hsa-miR-548m	CLIP-seq
MIRT2632568	hsa-miR-577	CLIP-seq
MIRT2691986	hsa-miR-608	CLIP-seq
MIRT2691987	hsa-miR-609	CLIP-seq
MIRT1388999	hsa-miR-633	CLIP-seq
MIRT1389000	hsa-miR-657	CLIP-seq
MIRT1554156	hsa-miR-892a	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001818	Process	Negative regulation of cytokine production	IEA
GO:0001818	Process	Negative regulation of cytokine production	ISS
GO:0005515	Function	Protein binding	IPI	11911826, 16189514, 21268013, 25416956, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IDA	11154222
GO:0005764	Component	Lysosome	IEA
GO:0005794	Component	Golgi apparatus	IDA	15136585
GO:0005794	Component	Golgi apparatus	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0016485	Process	Protein processing	IEA
GO:0016485	Process	Protein processing	ISS
GO:0030141	Component	Secretory granule	IBA
GO:0030502	Process	Negative regulation of bone mineralization	IBA
GO:0030502	Process	Negative regulation of bone mineralization	IDA	16870619
GO:0031012	Component	Extracellular matrix	HDA	33266304
GO:0031093	Component	Platelet alpha granule lumen	TAS
GO:0031214	Process	Biomineral tissue development	IEA
GO:0033363	Process	Secretory granule organization	IBA
GO:0033364	Process	Mast cell secretory granule organization	IEA
GO:0033364	Process	Mast cell secretory granule organization	ISS
GO:0033371	Process	T cell secretory granule organization	IEA
GO:0033371	Process	T cell secretory granule organization	ISS
GO:0033373	Process	Maintenance of protease location in mast cell secretory granule	IEA
GO:0033373	Process	Maintenance of protease location in mast cell secretory granule	ISS
GO:0033382	Process	Maintenance of granzyme B location in T cell secretory granule	IEA
GO:0033382	Process	Maintenance of granzyme B location in T cell secretory granule	ISS
GO:0042629	Component	Mast cell granule	IEA
GO:0042629	Component	Mast cell granule	ISS
GO:0044194	Component	Cytolytic granule	IEA
GO:0140507	Process	Granzyme-mediated programmed cell death signaling pathway	IDA	11911826

Other IDs

• MIM: 177040
• HGNC: 9361
• e!Ensembl: ENSG00000122862

Protein

• UniProt ID: P10124
• Protein name: Serglycin (Hematopoietic proteoglycan core protein) (Platelet proteoglycan core protein) (P.PG) (Secretory granule proteoglycan core protein)
• Protein function: Plays a role in formation of mast cell secretory granules and mediates storage of various compounds in secretory vesicles. Required for storage of some proteases in both connective tissue and mucosal mast cells and for storage of granzyme B in T
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF04360	Serglycin	3 → 151	Serglycin	Family

• Sequence:

  MMQKLLKCSRLVLALALILVLESSVQGYPTRRARYQWVRCNPDSNSANCLEEKGPMFELL
  PGESNKIPRLRTDLFPKTRIQDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDY
  QLVDESDAFHDNLRSLDRNLPSDSQDLGQHGLEEDFML

• Sequence length: 158

Pathways

Reactome:

Platelet degranulation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	11333275, 7504770		★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	1377686		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	27819672		★☆☆☆☆ Found in Text Mining only
Adolescent Gynecomastia	Pubertal gynecomastia	BEFREE	26845730		★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	21804080		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	39657893	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	31145901		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23527297, 24205138, 29842969		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24205138, 26581653, 27819672, 34924500	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	26527314	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	26581653		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36920176	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	27819672		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	30368515	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	30368515		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	26694746	Associate	★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	31455417	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	26581653		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30121667		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	24958816, 30121667, 34676149, 34814322, 39494275	Associate	★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	30368515		★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary Aneurysm	BEFREE	28612914		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	29313562		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	23376071, 29313562		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	29313562		★☆☆☆☆ Found in Text Mining only
Coronary Stenosis	Coronary Stenosis	BEFREE	29313562		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	30536194		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	BEFREE	21804080		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	21804080	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Complications	Diabetes complications	Pubtator	26694746	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	33314317	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	30244600, 31365765		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	30244600		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	33314317	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	36632458	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	36632458, 37561524	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28445977		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	28445977	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	28445977, 31773303		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	28445977		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	28445977, 37248887	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	30368515		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	30368515	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	31562900	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	40449756	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	31534974		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	26694746	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	30121667	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	29319363		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	29698332	Associate	★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	37965330	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	28886014		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	29286103, 35569433	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	1377686, 14506241	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	1723052, 17982622, 31452272		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	23996242		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	27819672	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	21804080		★☆☆☆☆ Found in Text Mining only
Lymphohistiocytosis Hemophagocytic	Hemophagocytic lymphohistiocytosis	Pubtator	31562900	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23527297, 24205138, 29842969		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	27819672		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23527297, 28445977, 29296842, 31145901, 31279836		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	26581653		★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	32370744	Stimulate	★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	34753832	Associate	★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	26671989, 28843862		★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	29523930	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	LHGDN	16870619		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	16870619	Stimulate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	23387827, 24403068		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	23387827	Associate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	21289131, 24995621		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	35562411	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21289131, 24403068, 24995621, 26581653, 27819672, 28145886, 31279836		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	27819672		★☆☆☆☆ Found in Text Mining only
Oligospermia	Oligospermia	BEFREE	31002754		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	34493692	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	37090158	Associate	★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Newborn	Congenital alveolar dysplasia	BEFREE	26507871		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	33070392	Associate	★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	24403068		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	22960999		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	34910689	Associate	★☆☆☆☆ Found in Text Mining only
Stable angina	Stable Angina	BEFREE	29313562		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	38425243	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	28692037		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	37391754	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	26694746	Associate	★☆☆☆☆ Found in Text Mining only