Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	55501
Gene name	Carbohydrate sulfotransferase 12
Gene symbol	CHST12
Synonyms (NCBI Gene)	C4S-2C4ST-2C4ST2
Chromosome	7
Chromosome location	7p22.3
Summary	The protein encoded by this gene belongs to the sulfotransferase 2 family. It is localized to the golgi membrane, and catalyzes the transfer of sulfate to position 4 of the N-acetylgalactosamine (GalNAc) residue of chondroitin and desulfated dermatan sulf

Show/Hide all (62)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023383	hsa-miR-122-5p	Microarray	17612493
MIRT024916	hsa-miR-215-5p	Microarray	19074876
MIRT026953	hsa-miR-192-5p	Microarray	19074876
MIRT030347	hsa-miR-26b-5p	Microarray	19088304
MIRT495309	hsa-miR-497-3p	PAR-CLIP	23708386
MIRT495308	hsa-miR-6715a-3p	PAR-CLIP	23708386
MIRT495307	hsa-miR-483-3p	PAR-CLIP	23708386
MIRT495306	hsa-miR-6777-3p	PAR-CLIP	23708386
MIRT495305	hsa-miR-4722-3p	PAR-CLIP	23708386
MIRT495303	hsa-miR-6727-3p	PAR-CLIP	23708386
MIRT495304	hsa-miR-6747-3p	PAR-CLIP	23708386
MIRT495302	hsa-miR-1976	PAR-CLIP	23708386
MIRT495301	hsa-miR-5189-3p	PAR-CLIP	23708386
MIRT491054	hsa-miR-658	PAR-CLIP	23592263
MIRT491053	hsa-miR-4767	PAR-CLIP	23592263
MIRT491052	hsa-miR-3656	PAR-CLIP	23592263
MIRT491051	hsa-miR-25-5p	PAR-CLIP	23592263
MIRT491049	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT491050	hsa-miR-8085	PAR-CLIP	23592263
MIRT491048	hsa-miR-3175	PAR-CLIP	23592263
MIRT491047	hsa-miR-6756-5p	PAR-CLIP	23592263
MIRT491046	hsa-miR-6766-5p	PAR-CLIP	23592263
MIRT491045	hsa-miR-541-3p	PAR-CLIP	23592263
MIRT491044	hsa-miR-654-5p	PAR-CLIP	23592263
MIRT491043	hsa-miR-1228-5p	PAR-CLIP	23592263
MIRT491042	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT495309	hsa-miR-497-3p	PAR-CLIP	23708386
MIRT495308	hsa-miR-6715a-3p	PAR-CLIP	23708386
MIRT495307	hsa-miR-483-3p	PAR-CLIP	23708386
MIRT495306	hsa-miR-6777-3p	PAR-CLIP	23708386
MIRT495305	hsa-miR-4722-3p	PAR-CLIP	23708386
MIRT495303	hsa-miR-6727-3p	PAR-CLIP	23708386
MIRT495304	hsa-miR-6747-3p	PAR-CLIP	23708386
MIRT495302	hsa-miR-1976	PAR-CLIP	23708386
MIRT495301	hsa-miR-5189-3p	PAR-CLIP	23708386
MIRT491054	hsa-miR-658	PAR-CLIP	23592263
MIRT491053	hsa-miR-4767	PAR-CLIP	23592263
MIRT491052	hsa-miR-3656	PAR-CLIP	23592263
MIRT491051	hsa-miR-25-5p	PAR-CLIP	23592263
MIRT491049	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT491050	hsa-miR-8085	PAR-CLIP	23592263
MIRT491048	hsa-miR-3175	PAR-CLIP	23592263
MIRT491047	hsa-miR-6756-5p	PAR-CLIP	23592263
MIRT491046	hsa-miR-6766-5p	PAR-CLIP	23592263
MIRT491045	hsa-miR-541-3p	PAR-CLIP	23592263
MIRT491044	hsa-miR-654-5p	PAR-CLIP	23592263
MIRT491043	hsa-miR-1228-5p	PAR-CLIP	23592263
MIRT491042	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT1964398	hsa-miR-4649-5p	CLIP-seq
MIRT1964399	hsa-miR-541	CLIP-seq
MIRT2200549	hsa-miR-1324	CLIP-seq
MIRT2200550	hsa-miR-1827	CLIP-seq
MIRT2200551	hsa-miR-3612	CLIP-seq
MIRT2200552	hsa-miR-4254	CLIP-seq
MIRT2200553	hsa-miR-4308	CLIP-seq
MIRT2200554	hsa-miR-4443	CLIP-seq
MIRT2200555	hsa-miR-4660	CLIP-seq
MIRT1964399	hsa-miR-541	CLIP-seq
MIRT2200556	hsa-miR-552	CLIP-seq
MIRT2200557	hsa-miR-617	CLIP-seq
MIRT2200558	hsa-miR-650	CLIP-seq
MIRT2200559	hsa-miR-764	CLIP-seq

Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	NAS	10781601
GO:0000139	Component	Golgi membrane	TAS
GO:0005794	Component	Golgi apparatus	IEA
GO:0008146	Function	Sulfotransferase activity	IBA
GO:0008146	Function	Sulfotransferase activity	IEA
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016051	Process	Carbohydrate biosynthetic process	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030166	Process	Proteoglycan biosynthetic process	IBA
GO:0047756	Function	Chondroitin 4-sulfotransferase activity	IDA	10781601
GO:0047756	Function	Chondroitin 4-sulfotransferase activity	IEA
GO:0047756	Function	Chondroitin 4-sulfotransferase activity	TAS
GO:0050650	Process	Chondroitin sulfate proteoglycan biosynthetic process	IDA	10781601
GO:0050650	Process	Chondroitin sulfate proteoglycan biosynthetic process	TAS
GO:0050651	Process	Dermatan sulfate proteoglycan biosynthetic process	IDA	10781601
GO:0050656	Function	3'-phosphoadenosine 5'-phosphosulfate binding	NAS	10781601

MIM	HGNC	e!Ensembl
610129	17423	ENSG00000136213

Q9NRB3

Protein name

Carbohydrate sulfotransferase 12 (EC 2.8.2.5) (Chondroitin 4-O-sulfotransferase 2) (Chondroitin 4-sulfotransferase 2) (C4ST-2) (C4ST2) (Sulfotransferase Hlo)

Protein function

Catalyzes the transfer of sulfate to position 4 of the N-acetylgalactosamine (GalNAc) residue of chondroitin and desulfated dermatan sulfate. Chondroitin sulfate constitutes the predominant proteoglycan present in cartilage and is distributed on

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03567	Sulfotransfer_2	155 → 406	Sulfotransferase family	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. Expressed a high level in spinal chord, heart, spleen, thyroid, pituitary gland, adrenal gland, peripheral blood leukocytes, thymus, lung, small intestine, fetal kidney, fetal spleen and fetal lung. {ECO:0000269|PubMe

Sequence

MTKARLFRLWLVLGSVFMILLIIVYWDSAGAAHFYLHTSFSRPHTGPPLPTPGPDRDREL
TADSDVDEFLDKFLSAGVKQSDLPRKETEQPPAPGSMEESVRGYDWSPRDARRSPDQGRQ
QAERRSVLRGFCANSSLAFPTKERAFDDIPNSELSHLIVDDRHGAIYCYVPKVACTNWKR
VMIVLSGSLLHRGAPYRDPLRIPREHVHNASAHLTFNKFWRRYGKLSRHLMKVKLKKYTK
FLFVRDPFVRLISAFRSKFELENEEFYRKFAVPMLRLYANHTSLPASAREAFRAGLKVSF
ANFIQYLLDPHTEKLAPFNEHWRQVYRLCHPCQIDYDFVGKLETLDEDAAQLLQLLQVDR
QLRFPPSYRNRTASSWEEDWFAKIPLAWRQQLYKLYEADFVLFGYPKPENLLRD

Sequence length

414

Interactions

View interactions

	KEGG		Reactome
	Glycosaminoglycan biosynthesis - chondroitin sulfate / dermatan sulfate		Chondroitin sulfate biosynthesis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPEROPIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (10)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Glioblastoma	Glioblastoma	Pubtator	33553434, 34288811	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kashin-Beck Disease	Kashin-Beck Disease	BEFREE	30661165, 31845005		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	26005050		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	26005050	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	26005050		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	26005050		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	26005050		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	23094030	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis	Osteoarthritis	Pubtator	28274888	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	26084610	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

CHST12 (carbohydrate sulfotransferase 12)