Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5547
Gene name	Prolylcarboxypeptidase
Gene symbol	PRCP
Synonyms (NCBI Gene)	HUMPCPPCP
Chromosome	11
Chromosome location	11q14.1
Summary	This gene encodes a member of the peptidase S28 family of serine exopeptidases. The encoded preproprotein is proteolytically processed to generate the mature lysosomal prolylcarboxypeptidase. This enzyme cleaves C-terminal amino acids linked to proline in

154

Show/Hide all (154)

miRTarBase ID	miRNA	Experiments	Reference
MIRT049856	hsa-miR-32-5p	CLASH	23622248
MIRT047903	hsa-miR-30c-5p	CLASH	23622248
MIRT666827	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT666826	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT666825	hsa-miR-3120-5p	HITS-CLIP	23824327
MIRT666824	hsa-miR-6895-3p	HITS-CLIP	23824327
MIRT666823	hsa-miR-593-3p	HITS-CLIP	23824327
MIRT666822	hsa-miR-3657	HITS-CLIP	23824327
MIRT666821	hsa-miR-4669	HITS-CLIP	23824327
MIRT666820	hsa-miR-4474-5p	HITS-CLIP	23824327
MIRT666819	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT666818	hsa-miR-6888-3p	HITS-CLIP	23824327
MIRT666817	hsa-miR-6818-3p	HITS-CLIP	23824327
MIRT666827	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT666826	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT666825	hsa-miR-3120-5p	HITS-CLIP	23824327
MIRT666824	hsa-miR-6895-3p	HITS-CLIP	23824327
MIRT666823	hsa-miR-593-3p	HITS-CLIP	23824327
MIRT666822	hsa-miR-3657	HITS-CLIP	23824327
MIRT666821	hsa-miR-4669	HITS-CLIP	23824327
MIRT666820	hsa-miR-4474-5p	HITS-CLIP	23824327
MIRT666819	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT666818	hsa-miR-6888-3p	HITS-CLIP	23824327
MIRT666817	hsa-miR-6818-3p	HITS-CLIP	23824327
MIRT1259846	hsa-miR-1271	CLIP-seq
MIRT737828	hsa-miR-1343	CLIP-seq
MIRT737827	hsa-miR-3690	CLIP-seq
MIRT737826	hsa-miR-4254	CLIP-seq
MIRT737829	hsa-miR-760	CLIP-seq
MIRT1259847	hsa-miR-96	CLIP-seq
MIRT1259848	hsa-miR-3120-3p	CLIP-seq
MIRT1259849	hsa-miR-3144-5p	CLIP-seq
MIRT1259850	hsa-miR-3191	CLIP-seq
MIRT1259851	hsa-miR-3926	CLIP-seq
MIRT1259852	hsa-miR-3973	CLIP-seq
MIRT1259853	hsa-miR-4640-5p	CLIP-seq
MIRT1259854	hsa-miR-4652-5p	CLIP-seq
MIRT1259855	hsa-miR-4699-3p	CLIP-seq
MIRT1259856	hsa-miR-4726-5p	CLIP-seq
MIRT1259857	hsa-miR-4742-3p	CLIP-seq
MIRT1259858	hsa-miR-4795-3p	CLIP-seq
MIRT1259859	hsa-miR-520d-5p	CLIP-seq
MIRT1259860	hsa-miR-520g	CLIP-seq
MIRT1259861	hsa-miR-520h	CLIP-seq
MIRT1259862	hsa-miR-524-5p	CLIP-seq
MIRT2076569	hsa-miR-605	CLIP-seq
MIRT737829	hsa-miR-760	CLIP-seq
MIRT2303168	hsa-miR-1302	CLIP-seq
MIRT2303169	hsa-miR-181a	CLIP-seq
MIRT2303170	hsa-miR-181b	CLIP-seq
MIRT2303171	hsa-miR-181c	CLIP-seq
MIRT2303172	hsa-miR-181d	CLIP-seq
MIRT2303173	hsa-miR-23a	CLIP-seq
MIRT2303174	hsa-miR-23b	CLIP-seq
MIRT2303175	hsa-miR-23c	CLIP-seq
MIRT1259848	hsa-miR-3120-3p	CLIP-seq
MIRT1259852	hsa-miR-3973	CLIP-seq
MIRT2303176	hsa-miR-4262	CLIP-seq
MIRT2303177	hsa-miR-4298	CLIP-seq
MIRT1259860	hsa-miR-520g	CLIP-seq
MIRT1259861	hsa-miR-520h	CLIP-seq
MIRT2439596	hsa-miR-4275	CLIP-seq
MIRT2439597	hsa-miR-499-3p	CLIP-seq
MIRT2439598	hsa-miR-499a-3p	CLIP-seq
MIRT2439599	hsa-miR-634	CLIP-seq
MIRT2439599	hsa-miR-634	CLIP-seq
MIRT2457095	hsa-miR-4680-5p	CLIP-seq
MIRT2457096	hsa-miR-873	CLIP-seq
MIRT2599844	hsa-miR-1323	CLIP-seq
MIRT2599845	hsa-miR-216b	CLIP-seq
MIRT2599846	hsa-miR-3140-3p	CLIP-seq
MIRT1259849	hsa-miR-3144-5p	CLIP-seq
MIRT2599847	hsa-miR-3182	CLIP-seq
MIRT1259850	hsa-miR-3191	CLIP-seq
MIRT2599848	hsa-miR-371b-5p	CLIP-seq
MIRT1259851	hsa-miR-3926	CLIP-seq
MIRT2439596	hsa-miR-4275	CLIP-seq
MIRT2599849	hsa-miR-4287	CLIP-seq
MIRT2599850	hsa-miR-4311	CLIP-seq
MIRT2599851	hsa-miR-4469	CLIP-seq
MIRT1259853	hsa-miR-4640-5p	CLIP-seq
MIRT1259854	hsa-miR-4652-5p	CLIP-seq
MIRT2599852	hsa-miR-4685-3p	CLIP-seq
MIRT2599853	hsa-miR-4714-3p	CLIP-seq
MIRT1259856	hsa-miR-4726-5p	CLIP-seq
MIRT2439597	hsa-miR-499-3p	CLIP-seq
MIRT2439598	hsa-miR-499a-3p	CLIP-seq
MIRT1259859	hsa-miR-520d-5p	CLIP-seq
MIRT1259862	hsa-miR-524-5p	CLIP-seq
MIRT2599854	hsa-miR-539	CLIP-seq
MIRT2599855	hsa-miR-548aa	CLIP-seq
MIRT2599856	hsa-miR-548o	CLIP-seq
MIRT2599857	hsa-miR-599	CLIP-seq
MIRT2439599	hsa-miR-634	CLIP-seq
MIRT2599858	hsa-miR-642a	CLIP-seq
MIRT2599844	hsa-miR-1323	CLIP-seq
MIRT2688514	hsa-miR-145	CLIP-seq
MIRT2599845	hsa-miR-216b	CLIP-seq
MIRT2688515	hsa-miR-2467-3p	CLIP-seq
MIRT2599846	hsa-miR-3140-3p	CLIP-seq
MIRT1259849	hsa-miR-3144-5p	CLIP-seq
MIRT2688516	hsa-miR-3145-5p	CLIP-seq
MIRT2599847	hsa-miR-3182	CLIP-seq
MIRT1259850	hsa-miR-3191	CLIP-seq
MIRT2688517	hsa-miR-3616-3p	CLIP-seq
MIRT2688518	hsa-miR-3650	CLIP-seq
MIRT2688519	hsa-miR-3678-3p	CLIP-seq
MIRT2599848	hsa-miR-371b-5p	CLIP-seq
MIRT2688520	hsa-miR-384	CLIP-seq
MIRT2688521	hsa-miR-3925-3p	CLIP-seq
MIRT1259851	hsa-miR-3926	CLIP-seq
MIRT2688522	hsa-miR-4252	CLIP-seq
MIRT2439596	hsa-miR-4275	CLIP-seq
MIRT2599849	hsa-miR-4287	CLIP-seq
MIRT2599850	hsa-miR-4311	CLIP-seq
MIRT2688523	hsa-miR-4327	CLIP-seq
MIRT2599851	hsa-miR-4469	CLIP-seq
MIRT1259853	hsa-miR-4640-5p	CLIP-seq
MIRT2688524	hsa-miR-4648	CLIP-seq
MIRT1259854	hsa-miR-4652-5p	CLIP-seq
MIRT2688525	hsa-miR-4654	CLIP-seq
MIRT2457095	hsa-miR-4680-5p	CLIP-seq
MIRT2599852	hsa-miR-4685-3p	CLIP-seq
MIRT2688526	hsa-miR-4699-5p	CLIP-seq
MIRT2599853	hsa-miR-4714-3p	CLIP-seq
MIRT2688527	hsa-miR-4721	CLIP-seq
MIRT1259856	hsa-miR-4726-5p	CLIP-seq
MIRT2688528	hsa-miR-4756-3p	CLIP-seq
MIRT2688529	hsa-miR-4769-5p	CLIP-seq
MIRT2439597	hsa-miR-499-3p	CLIP-seq
MIRT2439598	hsa-miR-499a-3p	CLIP-seq
MIRT2688530	hsa-miR-508-5p	CLIP-seq
MIRT1259859	hsa-miR-520d-5p	CLIP-seq
MIRT1259862	hsa-miR-524-5p	CLIP-seq
MIRT2599854	hsa-miR-539	CLIP-seq
MIRT2688531	hsa-miR-548a-5p	CLIP-seq
MIRT2599855	hsa-miR-548aa	CLIP-seq
MIRT2688532	hsa-miR-548ab	CLIP-seq
MIRT2688533	hsa-miR-548ak	CLIP-seq
MIRT2688534	hsa-miR-548b-5p	CLIP-seq
MIRT2688535	hsa-miR-548c-5p	CLIP-seq
MIRT2688536	hsa-miR-548d-5p	CLIP-seq
MIRT2688537	hsa-miR-548h	CLIP-seq
MIRT2688538	hsa-miR-548i	CLIP-seq
MIRT2688539	hsa-miR-548j	CLIP-seq
MIRT2599856	hsa-miR-548o	CLIP-seq
MIRT2688540	hsa-miR-548w	CLIP-seq
MIRT2688541	hsa-miR-548y	CLIP-seq
MIRT2688542	hsa-miR-559	CLIP-seq
MIRT2599857	hsa-miR-599	CLIP-seq
MIRT2688543	hsa-miR-618	CLIP-seq
MIRT2439599	hsa-miR-634	CLIP-seq
MIRT2599858	hsa-miR-642a	CLIP-seq
MIRT2457096	hsa-miR-873	CLIP-seq

Show/Hide all (29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002003	Process	Angiotensin maturation	IEA
GO:0002155	Process	Regulation of thyroid hormone receptor signaling pathway	IEA
GO:0002353	Process	Plasma kallikrein-kinin cascade	IEA
GO:0003085	Process	Negative regulation of systemic arterial blood pressure	IBA
GO:0003085	Process	Negative regulation of systemic arterial blood pressure	IEA
GO:0004180	Function	Carboxypeptidase activity	IEA
GO:0004181	Function	Metallocarboxypeptidase activity	IEA
GO:0004185	Function	Serine-type carboxypeptidase activity	IEA
GO:0004185	Function	Serine-type carboxypeptidase activity	TAS	28321
GO:0005515	Function	Protein binding	IPI	20517885
GO:0005576	Component	Extracellular region	IEA
GO:0005764	Component	Lysosome	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006508	Process	Proteolysis	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008239	Function	Dipeptidyl-peptidase activity	IBA
GO:0016787	Function	Hydrolase activity	IEA
GO:0035577	Component	Azurophil granule membrane	TAS
GO:0042593	Process	Glucose homeostasis	IEA
GO:0043535	Process	Regulation of blood vessel endothelial cell migration	IBA
GO:0043535	Process	Regulation of blood vessel endothelial cell migration	IEA
GO:0045178	Component	Basal part of cell	IEA
GO:0060055	Process	Angiogenesis involved in wound healing	IBA
GO:0060055	Process	Angiogenesis involved in wound healing	IEA
GO:0070008	Function	Serine-type exopeptidase activity	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0097009	Process	Energy homeostasis	IEA
GO:0101003	Component	Ficolin-1-rich granule membrane	TAS
GO:2000377	Process	Regulation of reactive oxygen species metabolic process	IEA

MIM	HGNC	e!Ensembl
176785	9344	ENSG00000137509

P42785

Protein name

Lysosomal Pro-X carboxypeptidase (EC 3.4.16.2) (Angiotensinase C) (Lysosomal carboxypeptidase C) (Proline carboxypeptidase) (Prolylcarboxypeptidase) (PRCP)

Protein function

Cleaves C-terminal amino acids linked to proline in peptides such as angiotensin II, III and des-Arg9-bradykinin. This cleavage occurs at acidic pH, but enzymatic activity is retained with some substrates at neutral pH.

PDB

3N2Z

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05577	Peptidase_S28	55 → 477	Serine carboxypeptidase S28	Domain

Tissue specificity

TISSUE SPECIFICITY: Highest levels in placenta, lung and liver. Also present in heart, brain, pancreas and kidney.

Sequence

MGRRALLLLLLSFLAPWATIALRPALRALGSLHLPTNPTSLPAVAKNYSVLYFQQKVDHF
GFNTVKTFNQRYLVADKYWKKNGGSILFYTGNEGDIIWFCNNTGFMWDVAEELKAMLVFA
EHRYYGESLPFGDNSFKDSRHLNFLTSEQALADFAELIKHLKRTIPGAENQPVIAIGGSY
GGMLAAWFRMKYPHMVVGALAASAPIWQFEDLVPCGVFMKIVTTDFRKSGPHCSESIHRS
WDAINRLSNTGSGLQWLTGALHLCSPLTSQDIQHLKDWISETWVNLAMVDYPYASNFLQP
LPAWPIKVVCQYLKNPNVSDSLLLQNIFQALNVYYNYSGQVKCLNISETATSSLGTLGWS
YQACTEVVMPFCTNGVDDMFEPHSWNLKELSDDCFQQWGVRPRPSWITTMYGGKNISSHT
NIVFSNGELDPWSGGGVTKDITDTLVAVTISEGAHHLDLRTKNALDPMSVLLARSLEVRH
MKNWIRDFYDSAGKQH

Sequence length

496

Interactions

View interactions

	KEGG		Reactome
	Renin-angiotensin system Protein digestion and absorption		Intrinsic Pathway of Fibrin Clot Formation Neutrophil degranulation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (47)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Anemia	Anemia	BEFREE	30906778		★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	32093803	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	25803781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	21087932, 24936056, 25803781	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	29392143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	28342897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29084595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34285715	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	28069929		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Hydrocephalus	Congenital Hydrocephalus	BEFREE	30930930		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniorachischisis	Craniorachischisis	BEFREE	21840926, 22095531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	28274335		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	23245768	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	22679278		★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	22679278, 32448049, 33319614	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	24726140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	28831120	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	35945262	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	16681991, 21297000, 28160049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	LHGDN	16681991		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	24625278		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	28342897, 29559911, 31580184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	29656260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25803781, 26754771		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	31621760		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	31603308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	28274335		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	31492096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	23245768	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	29772029		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	1359021		★★★★★ ★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	GWASDB_DG	19629137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	19129707, 21840926, 21864354, 21901791, 23223018, 24307374, 28718066, 29063958, 29618362, 30579764		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	18063347		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	19620779, 20857914		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	23245768	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	21087932		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	24936056	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary craniopharyngioma	Papillary Craniopharyngioma	BEFREE	11906051, 20671153, 24717047, 31409231		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	31621760		★★★★★ ★☆☆☆☆ Found in Text Mining only
Protein C Deficiency	Protein C Deficiency	BEFREE	10806561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	18063347		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	28237967		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	18396440		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	27335180, 28274335, 28342897, 30618660, 31580184, 9387886		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spina Bifida	Spina Bifida	BEFREE	20101694, 21840926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	28521453		★★★★★ ★☆☆☆☆ Found in Text Mining only

PRCP (prolylcarboxypeptidase)