Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5546
Gene name	Proline rich mitotic checkpoint control factor
Gene symbol	PRCC
Synonyms (NCBI Gene)	RCCP1TPRC
Chromosome	1
Chromosome location	1q23.1
Summary	This gene encodes a protein that may play a role in pre-mRNA splicing. Chromosomal translocations (X;1)(p11;q21) that result in fusion of this gene to TFE3 (GeneID 7030) have been associated with papillary renal cell carcinoma. A PRCC-TFE3 fusion protein

129

Show/Hide all (129)

miRTarBase ID	miRNA	Experiments	Reference
MIRT040762	hsa-miR-18a-3p	CLASH	23622248
MIRT039451	hsa-miR-421	CLASH	23622248
MIRT037286	hsa-miR-877-5p	CLASH	23622248
MIRT1259775	hsa-miR-1224-3p	CLIP-seq
MIRT1259776	hsa-miR-1225-3p	CLIP-seq
MIRT1259777	hsa-miR-1260	CLIP-seq
MIRT1259778	hsa-miR-1260b	CLIP-seq
MIRT1259779	hsa-miR-127-5p	CLIP-seq
MIRT1259780	hsa-miR-1280	CLIP-seq
MIRT1259781	hsa-miR-1972	CLIP-seq
MIRT1259782	hsa-miR-28-5p	CLIP-seq
MIRT1259783	hsa-miR-299-5p	CLIP-seq
MIRT1259784	hsa-miR-3127-3p	CLIP-seq
MIRT1259785	hsa-miR-3139	CLIP-seq
MIRT1259786	hsa-miR-3150a-3p	CLIP-seq
MIRT1259787	hsa-miR-3160-3p	CLIP-seq
MIRT1259788	hsa-miR-3175	CLIP-seq
MIRT1259789	hsa-miR-320e	CLIP-seq
MIRT1259790	hsa-miR-323-5p	CLIP-seq
MIRT1259791	hsa-miR-3612	CLIP-seq
MIRT1259792	hsa-miR-377	CLIP-seq
MIRT1259793	hsa-miR-4257	CLIP-seq
MIRT1259794	hsa-miR-4263	CLIP-seq
MIRT1259795	hsa-miR-4488	CLIP-seq
MIRT1259796	hsa-miR-4640-5p	CLIP-seq
MIRT1259797	hsa-miR-4680-3p	CLIP-seq
MIRT1259798	hsa-miR-4697-5p	CLIP-seq
MIRT1259799	hsa-miR-4726-5p	CLIP-seq
MIRT1259800	hsa-miR-4728-5p	CLIP-seq
MIRT1259801	hsa-miR-4731-3p	CLIP-seq
MIRT1259802	hsa-miR-4731-5p	CLIP-seq
MIRT1259803	hsa-miR-4755-3p	CLIP-seq
MIRT1259804	hsa-miR-4796-3p	CLIP-seq
MIRT1259805	hsa-miR-4801	CLIP-seq
MIRT1259806	hsa-miR-491-5p	CLIP-seq
MIRT1259807	hsa-miR-541	CLIP-seq
MIRT1259808	hsa-miR-548t	CLIP-seq
MIRT1259809	hsa-miR-576-5p	CLIP-seq
MIRT1259810	hsa-miR-637	CLIP-seq
MIRT1259811	hsa-miR-650	CLIP-seq
MIRT1259812	hsa-miR-654-5p	CLIP-seq
MIRT1259813	hsa-miR-708	CLIP-seq
MIRT1259814	hsa-miR-876-3p	CLIP-seq
MIRT1259815	hsa-miR-939	CLIP-seq
MIRT1259775	hsa-miR-1224-3p	CLIP-seq
MIRT1259776	hsa-miR-1225-3p	CLIP-seq
MIRT1259777	hsa-miR-1260	CLIP-seq
MIRT1259778	hsa-miR-1260b	CLIP-seq
MIRT1259780	hsa-miR-1280	CLIP-seq
MIRT2076558	hsa-miR-1323	CLIP-seq
MIRT2076559	hsa-miR-2110	CLIP-seq
MIRT1259784	hsa-miR-3127-3p	CLIP-seq
MIRT1259786	hsa-miR-3150a-3p	CLIP-seq
MIRT2076560	hsa-miR-3153	CLIP-seq
MIRT2076561	hsa-miR-3189-3p	CLIP-seq
MIRT1259791	hsa-miR-3612	CLIP-seq
MIRT2076562	hsa-miR-4271	CLIP-seq
MIRT2076563	hsa-miR-4311	CLIP-seq
MIRT2076564	hsa-miR-4725-3p	CLIP-seq
MIRT2076565	hsa-miR-532-3p	CLIP-seq
MIRT2076566	hsa-miR-548o	CLIP-seq
MIRT2076567	hsa-miR-548p	CLIP-seq
MIRT1259811	hsa-miR-650	CLIP-seq
MIRT2303154	hsa-miR-4436a	CLIP-seq
MIRT2303155	hsa-miR-665	CLIP-seq
MIRT2599834	hsa-miR-1206	CLIP-seq
MIRT1259775	hsa-miR-1224-3p	CLIP-seq
MIRT1259776	hsa-miR-1225-3p	CLIP-seq
MIRT1259777	hsa-miR-1260	CLIP-seq
MIRT1259778	hsa-miR-1260b	CLIP-seq
MIRT2599835	hsa-miR-1264	CLIP-seq
MIRT1259780	hsa-miR-1280	CLIP-seq
MIRT2599836	hsa-miR-1298	CLIP-seq
MIRT2076558	hsa-miR-1323	CLIP-seq
MIRT2599837	hsa-miR-2053	CLIP-seq
MIRT2599838	hsa-miR-2467-3p	CLIP-seq
MIRT1259782	hsa-miR-28-5p	CLIP-seq
MIRT1259784	hsa-miR-3127-3p	CLIP-seq
MIRT1259785	hsa-miR-3139	CLIP-seq
MIRT1259787	hsa-miR-3160-3p	CLIP-seq
MIRT1259791	hsa-miR-3612	CLIP-seq
MIRT2599839	hsa-miR-3653	CLIP-seq
MIRT2599840	hsa-miR-3658	CLIP-seq
MIRT2599841	hsa-miR-3671	CLIP-seq
MIRT1259792	hsa-miR-377	CLIP-seq
MIRT1259794	hsa-miR-4263	CLIP-seq
MIRT2303154	hsa-miR-4436a	CLIP-seq
MIRT1259797	hsa-miR-4680-3p	CLIP-seq
MIRT1259801	hsa-miR-4731-3p	CLIP-seq
MIRT1259805	hsa-miR-4801	CLIP-seq
MIRT2076565	hsa-miR-532-3p	CLIP-seq
MIRT2599842	hsa-miR-548c-3p	CLIP-seq
MIRT2076566	hsa-miR-548o	CLIP-seq
MIRT2076567	hsa-miR-548p	CLIP-seq
MIRT1259809	hsa-miR-576-5p	CLIP-seq
MIRT2599843	hsa-miR-621	CLIP-seq
MIRT1259811	hsa-miR-650	CLIP-seq
MIRT2303155	hsa-miR-665	CLIP-seq
MIRT1259813	hsa-miR-708	CLIP-seq
MIRT1259775	hsa-miR-1224-3p	CLIP-seq
MIRT1259776	hsa-miR-1225-3p	CLIP-seq
MIRT1259777	hsa-miR-1260	CLIP-seq
MIRT1259778	hsa-miR-1260b	CLIP-seq
MIRT2599835	hsa-miR-1264	CLIP-seq
MIRT1259780	hsa-miR-1280	CLIP-seq
MIRT2076558	hsa-miR-1323	CLIP-seq
MIRT2599837	hsa-miR-2053	CLIP-seq
MIRT1259782	hsa-miR-28-5p	CLIP-seq
MIRT1259784	hsa-miR-3127-3p	CLIP-seq
MIRT1259785	hsa-miR-3139	CLIP-seq
MIRT1259787	hsa-miR-3160-3p	CLIP-seq
MIRT1259791	hsa-miR-3612	CLIP-seq
MIRT2599839	hsa-miR-3653	CLIP-seq
MIRT2599840	hsa-miR-3658	CLIP-seq
MIRT1259792	hsa-miR-377	CLIP-seq
MIRT1259794	hsa-miR-4263	CLIP-seq
MIRT2303154	hsa-miR-4436a	CLIP-seq
MIRT1259797	hsa-miR-4680-3p	CLIP-seq
MIRT1259801	hsa-miR-4731-3p	CLIP-seq
MIRT1259805	hsa-miR-4801	CLIP-seq
MIRT2076565	hsa-miR-532-3p	CLIP-seq
MIRT2599842	hsa-miR-548c-3p	CLIP-seq
MIRT2076566	hsa-miR-548o	CLIP-seq
MIRT2076567	hsa-miR-548p	CLIP-seq
MIRT1259809	hsa-miR-576-5p	CLIP-seq
MIRT2599843	hsa-miR-621	CLIP-seq
MIRT1259811	hsa-miR-650	CLIP-seq
MIRT2303155	hsa-miR-665	CLIP-seq
MIRT1259813	hsa-miR-708	CLIP-seq

Show/Hide all (7)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	11717438, 26871637
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	11717438
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0016607	Component	Nuclear speck	IDA
GO:0051726	Process	Regulation of cell cycle	IDA	11717438

MIM	HGNC	e!Ensembl
179755	9343	ENSG00000143294

Q92733

Protein name

Proline-rich protein PRCC (Papillary renal cell carcinoma translocation-associated gene protein)

Protein function

May regulate cell cycle progression through interaction with MAD2L2.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10253	PRCC	275 → 491	Mitotic checkpoint regulator, MAD2B-interacting	Family

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous in fetal and adult tissues.

Sequence

MSLVAYASSDESEPDEAEPEPEEEEAVAPTSGPALGGLFASLPAPKGPALLPPPPQMLAP
AFPPPLLLPPPTGDPRLQPPPPLPFGLGGFPPPPGVSPAEAAGVGEGLGLGLPSPRGPGL
NLPPPIGGAGPPLGLPKPKKRKEPVKIAAPELHKGDSDSEEDEPTKKKTILQGSSEGTGL
SALLPQPKNLTVKETNRLLLPHAFSRKPSDGSPDTKPSRLASKTKTSSLAPVVGTTTTTP
SPSAIKAAAKSAALQVTKQITQEEDDSDEEVAPENFFSLPEKAEPPGVEPYPYPIPTVPE
ELPPGTEPEPAFQDDAANAPLEFKMAAGSSGAPWMPKPGDDYSYNQFSTYGDANAAGAYY
QDYYSGGYYPAQDPALVPPQEIAPDASFIDDEAFKRLQGKRNRGREEINFVEIKGDDQLS
GAQQWMTKSLTEEKTMKSFSKKKGEQPTGQQRRKHQITYLIHQAKERELELKNTWSENKL
SRRQTQAKYGF

Sequence length

491

Interactions

View interactions

	KEGG		Reactome
	Transcriptional misregulation in cancer Renal cell carcinoma		mRNA Splicing - Major Pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARCINOMA, RENAL CELL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Papillary renal cell carcinoma type 1	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SJOGREN SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
YOLK SAC TUMOR AND HIGH-GRADE IMMATURE TERATOMA	other	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (29)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Calcinosis	Calcinosis	Pubtator	29713041	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	35396773	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	12459622, 12766578, 15316311, 21602817		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	30900418		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	28949976, 33019842, 35118587, 35396773, 40061565	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromophobe Renal Cell Carcinoma	Chromophobe Carcinoma	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	15139053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Collecting Duct Carcinoma of the Kidney	Renal Carcinoma	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	11717438, 12351585, 15139053, 16807766, 26975036, 28949976, 29148086, 31043488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	31348270	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	30900418		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11717438		★★★★★ ★☆☆☆☆ Found in Text Mining only
MiT family translocation renal cell carcinoma	Renal Carcinoma	ORPHANET_DG	20073616, 22207547, 8872474		★★★★★ ★☆☆☆☆ Found in Text Mining only
MiT family translocation renal cell carcinoma	Renal Carcinoma	BEFREE	29148086		★★★★★ ★☆☆☆☆ Found in Text Mining only
MiT family translocation renal cell carcinoma	Renal Carcinoma	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	33019842	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	31822261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	31822261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15139053, 27931799, 30900418		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30900418		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	BEFREE	11717438, 28352227, 8872474		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	11313942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	10417759, 11313885, 11313942, 11717438, 12837690, 15139053, 16807766, 24309327, 26415891, 26975036, 28411178, 28949976, 29148086, 31043488, 8986805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcomatoid Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	29713041	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

PRCC (proline rich mitotic checkpoint control factor)