SIRPG (signal regulatory protein gamma)

Gene

• Entrez ID: 55423
• Gene name: Signal regulatory protein gamma
• Gene symbol: SIRPG
• Synonyms (NCBI Gene): CD172g, SIRP-B2, SIRPB2, SIRPgamma, bA77C3.1
• Chromosome: 20
• Chromosome location: 20p13
• Summary: The protein encoded by this gene is a member of the signal-regulatory protein (SIRP) family, and also belongs to the immunoglobulin superfamily. SIRP family members are receptor-type transmembrane glycoproteins known to be involved in the negative regulat

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT454686	hsa-miR-1909-3p	PAR-CLIP	23592263
MIRT454685	hsa-miR-6722-3p	PAR-CLIP	23592263
MIRT454684	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT454683	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT454681	hsa-miR-4736	PAR-CLIP	23592263
MIRT454682	hsa-miR-7150	PAR-CLIP	23592263
MIRT454686	hsa-miR-1909-3p	PAR-CLIP	23592263
MIRT454685	hsa-miR-6722-3p	PAR-CLIP	23592263
MIRT454684	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT454683	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT454681	hsa-miR-4736	PAR-CLIP	23592263
MIRT454682	hsa-miR-7150	PAR-CLIP	23592263
MIRT1350041	hsa-miR-548aa	CLIP-seq
MIRT2327868	hsa-miR-1252	CLIP-seq
MIRT2327869	hsa-miR-2682	CLIP-seq
MIRT2327870	hsa-miR-4476	CLIP-seq
MIRT2327871	hsa-miR-449c	CLIP-seq
MIRT2327872	hsa-miR-4533	CLIP-seq
MIRT2327873	hsa-miR-940	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	15383453, 32814053
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	TAS
GO:0007155	Process	Cell adhesion	IEA
GO:0007267	Process	Cell-cell signaling	TAS	9062191
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	15383453
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	9062191
GO:0016020	Component	Membrane	IDA	15383453
GO:0016020	Component	Membrane	IEA
GO:0022409	Process	Positive regulation of cell-cell adhesion	IDA	15383453
GO:0035556	Process	Intracellular signal transduction	TAS	9062191
GO:0050766	Process	Positive regulation of phagocytosis	IBA
GO:0050870	Process	Positive regulation of T cell activation	IBA
GO:0050870	Process	Positive regulation of T cell activation	IDA	15383453

Other IDs

• MIM: 605466
• HGNC: 15757
• e!Ensembl: ENSG00000089012

Protein

• UniProt ID: Q9P1W8
• Protein name: Signal-regulatory protein gamma (SIRP-gamma) (CD172 antigen-like family member B) (Signal-regulatory protein beta-2) (SIRP-b2) (SIRP-beta-2) (CD antigen CD172g)
• Protein function: Probable immunoglobulin-like cell surface receptor. On binding with CD47, mediates cell-cell adhesion. Engagement on T-cells by CD47 on antigen-presenting cells results in enhanced antigen-specific T-cell proliferation and costimulates T-cell ac
• PDB: 2JJW, 4I2X
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07686	V-set	36 → 139	Immunoglobulin V-set domain	Domain
  PF07654	C1-set	150 → 233	Immunoglobulin C1-set domain	Domain
  PF07654	C1-set	253 → 336	Immunoglobulin C1-set domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Detected in liver, and at very low levels in brain, heart, lung, pancreas, kidney, placenta and skeletal muscle. Expressed on CD4+ T-cells, CD8+ T-cells, CD56-bright natural killer (NK) cells, CD20+ cells, and all activated NK cells. M
• Sequence:

  MPVPASWPHPPGPFLLLTLLLGLTEVAGEEELQMIQPEKLLLVTVGKTATLHCTVTSLLP
  VGPVLWFRGVGPGRELIYNQKEGHFPRVTTVSDLTKRNNMDFSIRISSITPADVGTYYCV
  KFRKGSPENVEFKSGPGTEMALGAKPSAPVVLGPAARTTPEHTVSFTCESHGFSPRDITL
  KWFKNGNELSDFQTNVDPTGQSVAYSIRSTARVVLDPWDVRSQVICEVAHVTLQGDPLRG
  TANLSEAIRVPPTLEVTQQPMRVGNQVNVTCQVRKFYPQSLQLTWSENGNVCQRETASTL
  TENKDGTYNWTSWFLVNISDQRDDVVLTCQVKHDGQLAVSKRLALEVTVHQKDQSSDATP
  GPASSLTALLLIAVLLGPIYVPWKQKT

• Sequence length: 387

Pathways

KEGG:

Efferocytosis
Osteoclast differentiation

Reactome:

Cell surface interactions at the vascular wall
Signal regulatory protein family interactions

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BRAIN ANEURYSM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALE INFERTILITY WITH AZOOSPERMIA OR OLIGOZOOSPERMIA DUE TO SINGLE GENE MUTATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NARCOLEPSY-CATAPLEXY SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Autoimmune Diseases	Autoimmune Diseases	BEFREE	27199374, 30337675, 30579937		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	30337675, 30579937	Associate	★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	Pubtator	24303009	Associate	★☆☆☆☆ Found in Text Mining only
Azoospermia Nonobstructive	Nonobstructive azoospermia	Pubtator	30863997	Associate	★☆☆☆☆ Found in Text Mining only
Azoospermia, Nonobstructive	Azoospermia	BEFREE	30863997		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	39533565	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	21270831, 30337675, 30579937, 34799406, 39533565	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	GWASDB_DG	19430480		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	19430480, 25751624		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	30337675, 30579937		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	38274229	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	36096644	Associate	★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	30863997	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	35229723	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	19473566		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	35909944	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	39533565	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	GWASDB_DG	22190364		★☆☆☆☆ Found in Text Mining only
Narcolepsy	Narcolepsy	Pubtator	37188663	Associate	★☆☆☆☆ Found in Text Mining only
Non-obstructive azoospermia	Non-obstructive azoospermia	BEFREE	24162948		★☆☆☆☆ Found in Text Mining only
Oligospermia	Oligospermia	BEFREE	24303009		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	34091115	Associate	★☆☆☆☆ Found in Text Mining only