Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	55366
Gene name	Leucine rich repeat containing G protein-coupled receptor 4
Gene symbol	LGR4
Synonyms (NCBI Gene)	BNMD17DPSLGPR48
Chromosome	11
Chromosome location	11p14.1
Summary	The protein encoded by this gene is a G-protein coupled receptor that binds R-spondins and activates the Wnt signaling pathway. This Wnt signaling pathway activation is necessary for proper development of many organs of the body. [provided by RefSeq, Oct

432

Show/Hide all (432)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021855	hsa-miR-132-3p	Microarray	17612493
MIRT026058	hsa-miR-196a-5p	Sequencing	20371350
MIRT027834	hsa-miR-98-5p	Microarray	19088304
MIRT721939	hsa-miR-449b-3p	HITS-CLIP	19536157
MIRT721938	hsa-miR-4786-3p	HITS-CLIP	19536157
MIRT440328	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440328	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440328	hsa-miR-218-5p	ELISALuciferase reporter assayqRT-PCRWestern blot	26986507
MIRT440328	hsa-miR-218-5p	ELISALuciferase reporter assayqRT-PCRWestern blot	26986507
MIRT721939	hsa-miR-449b-3p	HITS-CLIP	19536157
MIRT721938	hsa-miR-4786-3p	HITS-CLIP	19536157
MIRT1108491	hsa-let-7a	CLIP-seq
MIRT1108492	hsa-let-7b	CLIP-seq
MIRT1108493	hsa-let-7c	CLIP-seq
MIRT1108494	hsa-let-7d	CLIP-seq
MIRT1108495	hsa-let-7e	CLIP-seq
MIRT1108496	hsa-let-7f	CLIP-seq
MIRT1108497	hsa-let-7g	CLIP-seq
MIRT1108498	hsa-let-7i	CLIP-seq
MIRT1108499	hsa-miR-1237	CLIP-seq
MIRT1108500	hsa-miR-1245b-3p	CLIP-seq
MIRT1108501	hsa-miR-1248	CLIP-seq
MIRT1108502	hsa-miR-132	CLIP-seq
MIRT1108503	hsa-miR-141	CLIP-seq
MIRT1108504	hsa-miR-144	CLIP-seq
MIRT1108505	hsa-miR-193a-3p	CLIP-seq
MIRT1108506	hsa-miR-193b	CLIP-seq
MIRT1108507	hsa-miR-200a	CLIP-seq
MIRT1108508	hsa-miR-2115	CLIP-seq
MIRT1108509	hsa-miR-2116	CLIP-seq
MIRT1108510	hsa-miR-212	CLIP-seq
MIRT1108511	hsa-miR-2682	CLIP-seq
MIRT1108512	hsa-miR-296-3p	CLIP-seq
MIRT1108513	hsa-miR-302a	CLIP-seq
MIRT1108514	hsa-miR-302b	CLIP-seq
MIRT1108515	hsa-miR-302c	CLIP-seq
MIRT1108516	hsa-miR-302d	CLIP-seq
MIRT1108517	hsa-miR-302e	CLIP-seq
MIRT1108518	hsa-miR-3163	CLIP-seq
MIRT1108519	hsa-miR-34a	CLIP-seq
MIRT1108520	hsa-miR-34c-5p	CLIP-seq
MIRT1108521	hsa-miR-361-5p	CLIP-seq
MIRT1108522	hsa-miR-3622a-5p	CLIP-seq
MIRT1108523	hsa-miR-3646	CLIP-seq
MIRT1108524	hsa-miR-3662	CLIP-seq
MIRT1108525	hsa-miR-372	CLIP-seq
MIRT1108526	hsa-miR-373	CLIP-seq
MIRT1108527	hsa-miR-374a	CLIP-seq
MIRT1108528	hsa-miR-374b	CLIP-seq
MIRT1108529	hsa-miR-4263	CLIP-seq
MIRT1108530	hsa-miR-4266	CLIP-seq
MIRT1108531	hsa-miR-4423-3p	CLIP-seq
MIRT1108532	hsa-miR-4458	CLIP-seq
MIRT1108533	hsa-miR-4477a	CLIP-seq
MIRT1108534	hsa-miR-449a	CLIP-seq
MIRT1108535	hsa-miR-449b	CLIP-seq
MIRT1108536	hsa-miR-449c	CLIP-seq
MIRT1108537	hsa-miR-4500	CLIP-seq
MIRT1108538	hsa-miR-4514	CLIP-seq
MIRT1108539	hsa-miR-4639-3p	CLIP-seq
MIRT1108540	hsa-miR-4645-5p	CLIP-seq
MIRT1108541	hsa-miR-4659a-3p	CLIP-seq
MIRT1108542	hsa-miR-4659b-3p	CLIP-seq
MIRT1108543	hsa-miR-4673	CLIP-seq
MIRT1108544	hsa-miR-4677-5p	CLIP-seq
MIRT1108545	hsa-miR-4691-3p	CLIP-seq
MIRT1108546	hsa-miR-4692	CLIP-seq
MIRT1108547	hsa-miR-4695-5p	CLIP-seq
MIRT1108548	hsa-miR-4715-3p	CLIP-seq
MIRT1108549	hsa-miR-4733-3p	CLIP-seq
MIRT1108550	hsa-miR-4778-3p	CLIP-seq
MIRT1108551	hsa-miR-4779	CLIP-seq
MIRT1108552	hsa-miR-516a-3p	CLIP-seq
MIRT1108553	hsa-miR-520a-3p	CLIP-seq
MIRT1108554	hsa-miR-520b	CLIP-seq
MIRT1108555	hsa-miR-520c-3p	CLIP-seq
MIRT1108556	hsa-miR-520d-3p	CLIP-seq
MIRT1108557	hsa-miR-520e	CLIP-seq
MIRT1108558	hsa-miR-520f	CLIP-seq
MIRT1108559	hsa-miR-548g	CLIP-seq
MIRT1108560	hsa-miR-563	CLIP-seq
MIRT1108561	hsa-miR-576-3p	CLIP-seq
MIRT1108562	hsa-miR-580	CLIP-seq
MIRT1108563	hsa-miR-582-5p	CLIP-seq
MIRT1108564	hsa-miR-622	CLIP-seq
MIRT1108565	hsa-miR-625	CLIP-seq
MIRT1108566	hsa-miR-651	CLIP-seq
MIRT1108567	hsa-miR-659	CLIP-seq
MIRT1108568	hsa-miR-885-3p	CLIP-seq
MIRT1108569	hsa-miR-889	CLIP-seq
MIRT1108570	hsa-miR-892b	CLIP-seq
MIRT1108571	hsa-miR-944	CLIP-seq
MIRT1108572	hsa-miR-98	CLIP-seq
MIRT1108491	hsa-let-7a	CLIP-seq
MIRT1108492	hsa-let-7b	CLIP-seq
MIRT1108493	hsa-let-7c	CLIP-seq
MIRT1108494	hsa-let-7d	CLIP-seq
MIRT1108495	hsa-let-7e	CLIP-seq
MIRT1108496	hsa-let-7f	CLIP-seq
MIRT1108497	hsa-let-7g	CLIP-seq
MIRT1108498	hsa-let-7i	CLIP-seq
MIRT2029973	hsa-miR-1244	CLIP-seq
MIRT1108500	hsa-miR-1245b-3p	CLIP-seq
MIRT1108502	hsa-miR-132	CLIP-seq
MIRT1108503	hsa-miR-141	CLIP-seq
MIRT2029974	hsa-miR-142-3p	CLIP-seq
MIRT1108505	hsa-miR-193a-3p	CLIP-seq
MIRT1108506	hsa-miR-193b	CLIP-seq
MIRT2029975	hsa-miR-198	CLIP-seq
MIRT1108507	hsa-miR-200a	CLIP-seq
MIRT1108509	hsa-miR-2116	CLIP-seq
MIRT1108510	hsa-miR-212	CLIP-seq
MIRT1108512	hsa-miR-296-3p	CLIP-seq
MIRT2029976	hsa-miR-300	CLIP-seq
MIRT2029977	hsa-miR-325	CLIP-seq
MIRT2029978	hsa-miR-33a	CLIP-seq
MIRT2029979	hsa-miR-33b	CLIP-seq
MIRT1108519	hsa-miR-34a	CLIP-seq
MIRT2029980	hsa-miR-34b	CLIP-seq
MIRT1108520	hsa-miR-34c-5p	CLIP-seq
MIRT1108521	hsa-miR-361-5p	CLIP-seq
MIRT2029981	hsa-miR-3647-3p	CLIP-seq
MIRT1108524	hsa-miR-3662	CLIP-seq
MIRT2029982	hsa-miR-381	CLIP-seq
MIRT1108530	hsa-miR-4266	CLIP-seq
MIRT2029983	hsa-miR-4267	CLIP-seq
MIRT2029984	hsa-miR-4280	CLIP-seq
MIRT1108532	hsa-miR-4458	CLIP-seq
MIRT1108534	hsa-miR-449a	CLIP-seq
MIRT1108535	hsa-miR-449b	CLIP-seq
MIRT1108537	hsa-miR-4500	CLIP-seq
MIRT1108539	hsa-miR-4639-3p	CLIP-seq
MIRT2029985	hsa-miR-4666-3p	CLIP-seq
MIRT1108544	hsa-miR-4677-5p	CLIP-seq
MIRT1108545	hsa-miR-4691-3p	CLIP-seq
MIRT1108547	hsa-miR-4695-5p	CLIP-seq
MIRT2029986	hsa-miR-4699-3p	CLIP-seq
MIRT2029987	hsa-miR-4719	CLIP-seq
MIRT1108551	hsa-miR-4779	CLIP-seq
MIRT2029988	hsa-miR-548l	CLIP-seq
MIRT1108561	hsa-miR-576-3p	CLIP-seq
MIRT1108562	hsa-miR-580	CLIP-seq
MIRT1108564	hsa-miR-622	CLIP-seq
MIRT2029989	hsa-miR-628-3p	CLIP-seq
MIRT1108566	hsa-miR-651	CLIP-seq
MIRT1108567	hsa-miR-659	CLIP-seq
MIRT1108568	hsa-miR-885-3p	CLIP-seq
MIRT1108569	hsa-miR-889	CLIP-seq
MIRT1108570	hsa-miR-892b	CLIP-seq
MIRT1108572	hsa-miR-98	CLIP-seq
MIRT1108491	hsa-let-7a	CLIP-seq
MIRT1108492	hsa-let-7b	CLIP-seq
MIRT1108493	hsa-let-7c	CLIP-seq
MIRT1108494	hsa-let-7d	CLIP-seq
MIRT1108495	hsa-let-7e	CLIP-seq
MIRT1108496	hsa-let-7f	CLIP-seq
MIRT1108497	hsa-let-7g	CLIP-seq
MIRT1108498	hsa-let-7i	CLIP-seq
MIRT2029973	hsa-miR-1244	CLIP-seq
MIRT1108500	hsa-miR-1245b-3p	CLIP-seq
MIRT2260873	hsa-miR-1260	CLIP-seq
MIRT2260874	hsa-miR-1260b	CLIP-seq
MIRT1108502	hsa-miR-132	CLIP-seq
MIRT2260875	hsa-miR-140-3p	CLIP-seq
MIRT1108503	hsa-miR-141	CLIP-seq
MIRT2260876	hsa-miR-188-3p	CLIP-seq
MIRT1108505	hsa-miR-193a-3p	CLIP-seq
MIRT1108506	hsa-miR-193b	CLIP-seq
MIRT1108507	hsa-miR-200a	CLIP-seq
MIRT1108508	hsa-miR-2115	CLIP-seq
MIRT1108509	hsa-miR-2116	CLIP-seq
MIRT2260877	hsa-miR-2117	CLIP-seq
MIRT1108510	hsa-miR-212	CLIP-seq
MIRT2260878	hsa-miR-2392	CLIP-seq
MIRT1108511	hsa-miR-2682	CLIP-seq
MIRT1108512	hsa-miR-296-3p	CLIP-seq
MIRT2029976	hsa-miR-300	CLIP-seq
MIRT1108513	hsa-miR-302a	CLIP-seq
MIRT1108514	hsa-miR-302b	CLIP-seq
MIRT1108515	hsa-miR-302c	CLIP-seq
MIRT1108516	hsa-miR-302d	CLIP-seq
MIRT1108517	hsa-miR-302e	CLIP-seq
MIRT2260879	hsa-miR-3065-5p	CLIP-seq
MIRT2260880	hsa-miR-31	CLIP-seq
MIRT2260881	hsa-miR-3156-3p	CLIP-seq
MIRT2260882	hsa-miR-3168	CLIP-seq
MIRT2260883	hsa-miR-323-3p	CLIP-seq
MIRT1108519	hsa-miR-34a	CLIP-seq
MIRT1108520	hsa-miR-34c-5p	CLIP-seq
MIRT1108522	hsa-miR-3622a-5p	CLIP-seq
MIRT1108523	hsa-miR-3646	CLIP-seq
MIRT2029981	hsa-miR-3647-3p	CLIP-seq
MIRT2260884	hsa-miR-365	CLIP-seq
MIRT1108524	hsa-miR-3662	CLIP-seq
MIRT2260885	hsa-miR-3667-3p	CLIP-seq
MIRT1108525	hsa-miR-372	CLIP-seq
MIRT1108526	hsa-miR-373	CLIP-seq
MIRT2029982	hsa-miR-381	CLIP-seq
MIRT2260886	hsa-miR-3924	CLIP-seq
MIRT2260887	hsa-miR-410	CLIP-seq
MIRT1108530	hsa-miR-4266	CLIP-seq
MIRT1108531	hsa-miR-4423-3p	CLIP-seq
MIRT1108532	hsa-miR-4458	CLIP-seq
MIRT2260888	hsa-miR-4476	CLIP-seq
MIRT1108533	hsa-miR-4477a	CLIP-seq
MIRT1108534	hsa-miR-449a	CLIP-seq
MIRT1108535	hsa-miR-449b	CLIP-seq
MIRT1108536	hsa-miR-449c	CLIP-seq
MIRT1108537	hsa-miR-4500	CLIP-seq
MIRT1108538	hsa-miR-4514	CLIP-seq
MIRT1108539	hsa-miR-4639-3p	CLIP-seq
MIRT1108540	hsa-miR-4645-5p	CLIP-seq
MIRT2029985	hsa-miR-4666-3p	CLIP-seq
MIRT2260889	hsa-miR-4666-5p	CLIP-seq
MIRT1108543	hsa-miR-4673	CLIP-seq
MIRT1108544	hsa-miR-4677-5p	CLIP-seq
MIRT1108545	hsa-miR-4691-3p	CLIP-seq
MIRT1108546	hsa-miR-4692	CLIP-seq
MIRT1108547	hsa-miR-4695-5p	CLIP-seq
MIRT1108549	hsa-miR-4733-3p	CLIP-seq
MIRT2260890	hsa-miR-4735-5p	CLIP-seq
MIRT2260891	hsa-miR-4753-3p	CLIP-seq
MIRT1108551	hsa-miR-4779	CLIP-seq
MIRT2260892	hsa-miR-4789-5p	CLIP-seq
MIRT2260893	hsa-miR-500a	CLIP-seq
MIRT1108552	hsa-miR-516a-3p	CLIP-seq
MIRT1108553	hsa-miR-520a-3p	CLIP-seq
MIRT1108554	hsa-miR-520b	CLIP-seq
MIRT1108555	hsa-miR-520c-3p	CLIP-seq
MIRT1108556	hsa-miR-520d-3p	CLIP-seq
MIRT1108557	hsa-miR-520e	CLIP-seq
MIRT1108558	hsa-miR-520f	CLIP-seq
MIRT2260894	hsa-miR-553	CLIP-seq
MIRT2260895	hsa-miR-556-3p	CLIP-seq
MIRT1108560	hsa-miR-563	CLIP-seq
MIRT1108562	hsa-miR-580	CLIP-seq
MIRT2260896	hsa-miR-603	CLIP-seq
MIRT2260897	hsa-miR-605	CLIP-seq
MIRT1108564	hsa-miR-622	CLIP-seq
MIRT1108565	hsa-miR-625	CLIP-seq
MIRT1108566	hsa-miR-651	CLIP-seq
MIRT1108567	hsa-miR-659	CLIP-seq
MIRT2260898	hsa-miR-664	CLIP-seq
MIRT1108568	hsa-miR-885-3p	CLIP-seq
MIRT1108570	hsa-miR-892b	CLIP-seq
MIRT1108572	hsa-miR-98	CLIP-seq
MIRT1108502	hsa-miR-132	CLIP-seq
MIRT1108504	hsa-miR-144	CLIP-seq
MIRT1108505	hsa-miR-193a-3p	CLIP-seq
MIRT1108506	hsa-miR-193b	CLIP-seq
MIRT1108510	hsa-miR-212	CLIP-seq
MIRT2390107	hsa-miR-4528	CLIP-seq
MIRT1108545	hsa-miR-4691-3p	CLIP-seq
MIRT2390108	hsa-miR-4760-3p	CLIP-seq
MIRT2390109	hsa-miR-501-3p	CLIP-seq
MIRT2390110	hsa-miR-502-3p	CLIP-seq
MIRT1108564	hsa-miR-622	CLIP-seq
MIRT2260898	hsa-miR-664	CLIP-seq
MIRT1108568	hsa-miR-885-3p	CLIP-seq
MIRT1108570	hsa-miR-892b	CLIP-seq
MIRT2260879	hsa-miR-3065-5p	CLIP-seq
MIRT2029986	hsa-miR-4699-3p	CLIP-seq
MIRT2438349	hsa-miR-548u	CLIP-seq
MIRT2452989	hsa-miR-1291	CLIP-seq
MIRT2452990	hsa-miR-129-5p	CLIP-seq
MIRT2452991	hsa-miR-1302	CLIP-seq
MIRT2452992	hsa-miR-204	CLIP-seq
MIRT2452993	hsa-miR-211	CLIP-seq
MIRT2452994	hsa-miR-2114	CLIP-seq
MIRT2452995	hsa-miR-328	CLIP-seq
MIRT2452996	hsa-miR-4298	CLIP-seq
MIRT1108491	hsa-let-7a	CLIP-seq
MIRT1108492	hsa-let-7b	CLIP-seq
MIRT1108493	hsa-let-7c	CLIP-seq
MIRT1108494	hsa-let-7d	CLIP-seq
MIRT1108495	hsa-let-7e	CLIP-seq
MIRT1108496	hsa-let-7f	CLIP-seq
MIRT1108497	hsa-let-7g	CLIP-seq
MIRT1108498	hsa-let-7i	CLIP-seq
MIRT1108500	hsa-miR-1245b-3p	CLIP-seq
MIRT1108502	hsa-miR-132	CLIP-seq
MIRT1108503	hsa-miR-141	CLIP-seq
MIRT2560936	hsa-miR-146a	CLIP-seq
MIRT2560937	hsa-miR-146b-5p	CLIP-seq
MIRT1108505	hsa-miR-193a-3p	CLIP-seq
MIRT1108506	hsa-miR-193b	CLIP-seq
MIRT2029975	hsa-miR-198	CLIP-seq
MIRT1108507	hsa-miR-200a	CLIP-seq
MIRT1108508	hsa-miR-2115	CLIP-seq
MIRT1108510	hsa-miR-212	CLIP-seq
MIRT1108511	hsa-miR-2682	CLIP-seq
MIRT1108512	hsa-miR-296-3p	CLIP-seq
MIRT1108513	hsa-miR-302a	CLIP-seq
MIRT1108514	hsa-miR-302b	CLIP-seq
MIRT1108515	hsa-miR-302c	CLIP-seq
MIRT1108516	hsa-miR-302d	CLIP-seq
MIRT1108517	hsa-miR-302e	CLIP-seq
MIRT2260879	hsa-miR-3065-5p	CLIP-seq
MIRT2560938	hsa-miR-3148	CLIP-seq
MIRT2260883	hsa-miR-323-3p	CLIP-seq
MIRT1108519	hsa-miR-34a	CLIP-seq
MIRT1108520	hsa-miR-34c-5p	CLIP-seq
MIRT1108523	hsa-miR-3646	CLIP-seq
MIRT1108525	hsa-miR-372	CLIP-seq
MIRT1108526	hsa-miR-373	CLIP-seq
MIRT2560939	hsa-miR-3913-3p	CLIP-seq
MIRT2560940	hsa-miR-3978	CLIP-seq
MIRT2260887	hsa-miR-410	CLIP-seq
MIRT2560941	hsa-miR-411	CLIP-seq
MIRT1108530	hsa-miR-4266	CLIP-seq
MIRT2029983	hsa-miR-4267	CLIP-seq
MIRT2560942	hsa-miR-4330	CLIP-seq
MIRT1108532	hsa-miR-4458	CLIP-seq
MIRT2260888	hsa-miR-4476	CLIP-seq
MIRT1108534	hsa-miR-449a	CLIP-seq
MIRT1108535	hsa-miR-449b	CLIP-seq
MIRT1108536	hsa-miR-449c	CLIP-seq
MIRT1108537	hsa-miR-4500	CLIP-seq
MIRT1108538	hsa-miR-4514	CLIP-seq
MIRT1108539	hsa-miR-4639-3p	CLIP-seq
MIRT1108540	hsa-miR-4645-5p	CLIP-seq
MIRT2260889	hsa-miR-4666-5p	CLIP-seq
MIRT1108543	hsa-miR-4673	CLIP-seq
MIRT1108545	hsa-miR-4691-3p	CLIP-seq
MIRT1108546	hsa-miR-4692	CLIP-seq
MIRT1108547	hsa-miR-4695-5p	CLIP-seq
MIRT2029986	hsa-miR-4699-3p	CLIP-seq
MIRT2560943	hsa-miR-4732-5p	CLIP-seq
MIRT1108549	hsa-miR-4733-3p	CLIP-seq
MIRT1108551	hsa-miR-4779	CLIP-seq
MIRT2560944	hsa-miR-489	CLIP-seq
MIRT1108552	hsa-miR-516a-3p	CLIP-seq
MIRT1108553	hsa-miR-520a-3p	CLIP-seq
MIRT1108554	hsa-miR-520b	CLIP-seq
MIRT1108555	hsa-miR-520c-3p	CLIP-seq
MIRT1108556	hsa-miR-520d-3p	CLIP-seq
MIRT1108557	hsa-miR-520e	CLIP-seq
MIRT1108558	hsa-miR-520f	CLIP-seq
MIRT2560945	hsa-miR-545	CLIP-seq
MIRT2029988	hsa-miR-548l	CLIP-seq
MIRT2560946	hsa-miR-548n	CLIP-seq
MIRT2438349	hsa-miR-548u	CLIP-seq
MIRT2560947	hsa-miR-570	CLIP-seq
MIRT1108562	hsa-miR-580	CLIP-seq
MIRT2560948	hsa-miR-589	CLIP-seq
MIRT2260897	hsa-miR-605	CLIP-seq
MIRT1108564	hsa-miR-622	CLIP-seq
MIRT1108566	hsa-miR-651	CLIP-seq
MIRT1108567	hsa-miR-659	CLIP-seq
MIRT2260898	hsa-miR-664	CLIP-seq
MIRT1108568	hsa-miR-885-3p	CLIP-seq
MIRT1108570	hsa-miR-892b	CLIP-seq
MIRT1108572	hsa-miR-98	CLIP-seq
MIRT1108491	hsa-let-7a	CLIP-seq
MIRT1108492	hsa-let-7b	CLIP-seq
MIRT1108493	hsa-let-7c	CLIP-seq
MIRT1108494	hsa-let-7d	CLIP-seq
MIRT1108495	hsa-let-7e	CLIP-seq
MIRT1108496	hsa-let-7f	CLIP-seq
MIRT1108497	hsa-let-7g	CLIP-seq
MIRT1108498	hsa-let-7i	CLIP-seq
MIRT1108500	hsa-miR-1245b-3p	CLIP-seq
MIRT1108502	hsa-miR-132	CLIP-seq
MIRT2560936	hsa-miR-146a	CLIP-seq
MIRT2560937	hsa-miR-146b-5p	CLIP-seq
MIRT1108505	hsa-miR-193a-3p	CLIP-seq
MIRT1108506	hsa-miR-193b	CLIP-seq
MIRT2029975	hsa-miR-198	CLIP-seq
MIRT1108508	hsa-miR-2115	CLIP-seq
MIRT1108510	hsa-miR-212	CLIP-seq
MIRT1108511	hsa-miR-2682	CLIP-seq
MIRT1108512	hsa-miR-296-3p	CLIP-seq
MIRT1108513	hsa-miR-302a	CLIP-seq
MIRT1108514	hsa-miR-302b	CLIP-seq
MIRT1108515	hsa-miR-302c	CLIP-seq
MIRT1108516	hsa-miR-302d	CLIP-seq
MIRT1108517	hsa-miR-302e	CLIP-seq
MIRT2260879	hsa-miR-3065-5p	CLIP-seq
MIRT2560938	hsa-miR-3148	CLIP-seq
MIRT2260883	hsa-miR-323-3p	CLIP-seq
MIRT1108519	hsa-miR-34a	CLIP-seq
MIRT1108520	hsa-miR-34c-5p	CLIP-seq
MIRT1108523	hsa-miR-3646	CLIP-seq
MIRT1108525	hsa-miR-372	CLIP-seq
MIRT1108526	hsa-miR-373	CLIP-seq
MIRT2560939	hsa-miR-3913-3p	CLIP-seq
MIRT2560940	hsa-miR-3978	CLIP-seq
MIRT2260887	hsa-miR-410	CLIP-seq
MIRT2560941	hsa-miR-411	CLIP-seq
MIRT1108530	hsa-miR-4266	CLIP-seq
MIRT2029983	hsa-miR-4267	CLIP-seq
MIRT2560942	hsa-miR-4330	CLIP-seq
MIRT1108532	hsa-miR-4458	CLIP-seq
MIRT2260888	hsa-miR-4476	CLIP-seq
MIRT1108534	hsa-miR-449a	CLIP-seq
MIRT1108535	hsa-miR-449b	CLIP-seq
MIRT1108536	hsa-miR-449c	CLIP-seq
MIRT1108537	hsa-miR-4500	CLIP-seq
MIRT1108538	hsa-miR-4514	CLIP-seq
MIRT1108539	hsa-miR-4639-3p	CLIP-seq
MIRT1108540	hsa-miR-4645-5p	CLIP-seq
MIRT2260889	hsa-miR-4666-5p	CLIP-seq
MIRT1108543	hsa-miR-4673	CLIP-seq
MIRT1108545	hsa-miR-4691-3p	CLIP-seq
MIRT1108546	hsa-miR-4692	CLIP-seq
MIRT1108547	hsa-miR-4695-5p	CLIP-seq
MIRT2029986	hsa-miR-4699-3p	CLIP-seq
MIRT2560943	hsa-miR-4732-5p	CLIP-seq
MIRT1108549	hsa-miR-4733-3p	CLIP-seq
MIRT1108551	hsa-miR-4779	CLIP-seq
MIRT2560944	hsa-miR-489	CLIP-seq
MIRT1108552	hsa-miR-516a-3p	CLIP-seq
MIRT1108553	hsa-miR-520a-3p	CLIP-seq
MIRT1108554	hsa-miR-520b	CLIP-seq
MIRT1108555	hsa-miR-520c-3p	CLIP-seq
MIRT1108556	hsa-miR-520d-3p	CLIP-seq
MIRT1108557	hsa-miR-520e	CLIP-seq
MIRT1108558	hsa-miR-520f	CLIP-seq
MIRT2560945	hsa-miR-545	CLIP-seq
MIRT2029988	hsa-miR-548l	CLIP-seq
MIRT2560946	hsa-miR-548n	CLIP-seq
MIRT2438349	hsa-miR-548u	CLIP-seq
MIRT2560947	hsa-miR-570	CLIP-seq
MIRT1108562	hsa-miR-580	CLIP-seq
MIRT2560948	hsa-miR-589	CLIP-seq
MIRT2260897	hsa-miR-605	CLIP-seq
MIRT1108564	hsa-miR-622	CLIP-seq
MIRT1108566	hsa-miR-651	CLIP-seq
MIRT2260898	hsa-miR-664	CLIP-seq
MIRT1108568	hsa-miR-885-3p	CLIP-seq
MIRT1108570	hsa-miR-892b	CLIP-seq
MIRT1108572	hsa-miR-98	CLIP-seq

Show/Hide all (49)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001649	Process	Osteoblast differentiation	IEA
GO:0001649	Process	Osteoblast differentiation	ISS
GO:0001818	Process	Negative regulation of cytokine production	IEA
GO:0001818	Process	Negative regulation of cytokine production	ISS
GO:0001942	Process	Hair follicle development	IEA
GO:0002376	Process	Immune system process	IEA
GO:0004888	Function	Transmembrane signaling receptor activity	IDA	21727895, 22815884
GO:0004888	Function	Transmembrane signaling receptor activity	IEA
GO:0004930	Function	G protein-coupled receptor activity	IDA	22815884
GO:0004930	Function	G protein-coupled receptor activity	TAS	10894923
GO:0005515	Function	Protein binding	IPI	21727895, 22575959, 22815884, 32296183
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	22815884
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0007283	Process	Spermatogenesis	ISS
GO:0007623	Process	Circadian rhythm	IEA
GO:0016020	Component	Membrane	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0016500	Function	Protein-hormone receptor activity	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030177	Process	Positive regulation of Wnt signaling pathway	IEA
GO:0030282	Process	Bone mineralization	IEA
GO:0030282	Process	Bone mineralization	ISS
GO:0030539	Process	Male genitalia development	IEA
GO:0032922	Process	Circadian regulation of gene expression	IEA
GO:0032922	Process	Circadian regulation of gene expression	ISS
GO:0034122	Process	Negative regulation of toll-like receptor signaling pathway	IEA
GO:0034122	Process	Negative regulation of toll-like receptor signaling pathway	ISS
GO:0035239	Process	Tube morphogenesis	IEA
GO:0036335	Process	Intestinal stem cell homeostasis	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0046849	Process	Bone remodeling	IEA
GO:0046849	Process	Bone remodeling	ISS
GO:0048511	Process	Rhythmic process	IEA
GO:0048565	Process	Digestive tract development	IEA
GO:0050673	Process	Epithelial cell proliferation	IEA
GO:0072224	Process	Metanephric glomerulus development	IEA
GO:0072282	Process	Metanephric nephron tubule morphogenesis	IEA
GO:0090190	Process	Positive regulation of branching involved in ureteric bud morphogenesis	IEA
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IBA
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IDA	22815884
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IEA
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	IEA
GO:0120163	Process	Negative regulation of cold-induced thermogenesis	ISS	24212090
GO:2001013	Process	Epithelial cell proliferation involved in renal tubule morphogenesis	IEA

MIM	HGNC	e!Ensembl
606666	13299	ENSG00000205213

Q9BXB1

Protein name

Leucine-rich repeat-containing G-protein coupled receptor 4 (G-protein coupled receptor 48)

Protein function

Receptor for R-spondins that potentiates the canonical Wnt signaling pathway and is involved in the formation of various organs. Upon binding to R-spondins (RSPO1, RSPO2, RSPO3 or RSPO4), associates with phosphorylated LRP6 and frizzled receptor

PDB

4KT1 , 4QXE , 4QXF , 8WVU , 8WVV , 8WVW , 8WVX , 8WVY , 8XFP , 8XFS , 8XFT , 8XT9 , 8XUM , 8Y69

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01462	LRRNT	29 → 56	Leucine rich repeat N-terminal domain	Family
PF13855	LRR_8	59 → 117	Leucine rich repeat	Repeat
PF13855	LRR_8	105 → 165	Leucine rich repeat	Repeat
PF13855	LRR_8	177 → 237	Leucine rich repeat	Repeat
PF13855	LRR_8	248 → 307	Leucine rich repeat	Repeat
PF13855	LRR_8	319 → 377	Leucine rich repeat	Repeat
PF13855	LRR_8	365 → 425	Leucine rich repeat	Repeat
PF00001	7tm_1	555 → 801	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in multiple steroidogenic tissues: placenta, ovary, testis and adrenal. Expressed also in spinal cord, thyroid, stomach, trachea, heart, pancreas, kidney, prostate and spleen.

Sequence

MPGPLGLLCFLALGLLGSAGPSGAAPPLCAAPCSCDGDRRVDCSGKGLTAVPEGLSAFTQ
ALDISMNNITQLPEDAFKNFPFLEELQLAGNDLSFIHPKALSGLKELKVLTLQNNQLKTV
PSEAIRGLSALQSLRLDANHITSVPEDSFEGLVQLRHLWLDDNSLTEVPVHPLSNLPTLQ
ALTLALNKISSIPDFAFTNLSSLVVLHLHNNKIRSLSQHCFDGLDNLETLDLNYNNLGEF
PQAIKALPSLKELGFHSNSISVIPDGAFDGNPLLRTIHLYDNPLSFVGNSAFHNLSDLHS
LVIRGASMVQQFPNLTGTVHLESLTLTGTKISSIPNNLCQEQKMLRTLDLSYNNIRDLPS
FNGCHALEEISLQRNQIYQIKEGTFQGLISLRILDLSRNLIHEIHSRAFATLGPITNLDV
SFNELTSFPTEGLNGLNQLKLVGNFKLKEALAAKDFVNLRSLSVPYAYQCCAFWGCDSYA
NLNTEDNSLQDHSVAQEKGTADAANVTSTLENEEHSQIIIHCTPSTGAFKPCEYLLGSWM
IRLTVWFIFLVALFFNLLVILTTFASCTSLPSSKLFIGLISVSNLFMGIYTGILTFLDAV
SWGRFAEFGIWWETGSGCKVAGFLAVFSSESAIFLLMLATVERSLSAKDIMKNGKSNHLK
QFRVAALLAFLGATVAGCFPLFHRGEYSASPLCLPFPTGETPSLGFTVTLVLLNSLAFLL
MAVIYTKLYCNLEKEDLSENSQSSMIKHVAWLIFTNCIFFCPVAFFSFAPLITAISISPE
IMKSVTLIFFPLPACLNPVLYVFFNPKFKEDWKLLKRRVTKKSGSVSVSISSQGGCLEQD
FYYDCGMYSHLQGNLTVCDCCESFLLTKPVSCKHLIKSHSCPALAVASCQRPEGYWSDCG
TQSAHSDYADEEDSFVSDSSDQVQACGRACFYQSRGFPLVRYAYNLPRVKD

Sequence length

951

Interactions

View interactions

	KEGG		Reactome
	Wnt signaling pathway		Regulation of FZD by ubiquitination

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Delayed puberty, self-limited	Pathogenic	rs757351670, rs34804482	RCV001777185 RCV001777186	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (11)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bone mineral density quantitative trait locus 17	association	ClinVar CTD, ClinVar	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LGR4-related disorder	Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (62)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alopecia	Alopecia	GWASCAT_DG	28196072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aniridia	Aniridia	BEFREE	24519938		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anonychia congenita	Anonychia	Pubtator	23809763	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	27743893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	31486476		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	23589304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bicuspid Aortic Valve Disease	Bicuspid aortic valve	Pubtator	36071494	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	39525853	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	29269400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	17178856		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35170199	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	25531322, 29967265		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	38308339	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	18057535	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	36008975	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23803691		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35008827	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	28777797, 31486476		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	30307757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diarrhea	Diarrhea	Pubtator	39525853	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	29383135		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	24083766		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	24083766	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Hypersensitivity	Pubtator	30803215	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	30307757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	24519938		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	39525853	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	29269400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	25531322, 29967265		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	25636507, 26986507, 27743893, 28768769		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	23803691		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	29383135		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23803691, 24083742, 26986507, 29967265		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	29269400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	24519938		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	28028233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	29212806	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25636507, 27743893, 28768769, 29269400, 29383135		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30128865		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	24212090, 27925416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	26449484, 34707566	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity Abdominal	Obesity	Pubtator	27925416	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	28777797	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	27064449		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	29786747		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	39525853	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	24455684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	24455684	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	32176632	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	29383135		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	27693558		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	25636507, 26986507, 27743893, 28768769		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	28768769		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	28945253		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	31097406		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	23803691		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	30803215	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	29383135		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	29383135		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	31661551		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vesicular Stomatitis	Vesicular Stomatitis	BEFREE	28842478		★★★★★ ★☆☆☆☆ Found in Text Mining only
WAGR Syndrome	WAGR Syndrome	BEFREE	24519938		★★★★★ ★☆☆☆☆ Found in Text Mining only

LGR4 (leucine rich repeat containing G protein-coupled receptor 4)