Gene Gene information from NCBI Gene database.
Entrez ID 55366
Gene name Leucine rich repeat containing G protein-coupled receptor 4
Gene symbol LGR4
Synonyms (NCBI Gene)
BNMD17DPSLGPR48
Chromosome 11
Chromosome location 11p14.1
Summary The protein encoded by this gene is a G-protein coupled receptor that binds R-spondins and activates the Wnt signaling pathway. This Wnt signaling pathway activation is necessary for proper development of many organs of the body. [provided by RefSeq, Oct
miRNA miRNA information provided by mirtarbase database.
432
miRTarBase ID miRNA Experiments Reference
MIRT021855 hsa-miR-132-3p Microarray 17612493
MIRT026058 hsa-miR-196a-5p Sequencing 20371350
MIRT027834 hsa-miR-98-5p Microarray 19088304
MIRT721939 hsa-miR-449b-3p HITS-CLIP 19536157
MIRT721938 hsa-miR-4786-3p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
49
GO ID Ontology Definition Evidence Reference
GO:0001649 Process Osteoblast differentiation IEA
GO:0001649 Process Osteoblast differentiation ISS
GO:0001818 Process Negative regulation of cytokine production IEA
GO:0001818 Process Negative regulation of cytokine production ISS
GO:0001942 Process Hair follicle development IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
606666 13299 ENSG00000205213
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9BXB1
Protein name Leucine-rich repeat-containing G-protein coupled receptor 4 (G-protein coupled receptor 48)
Protein function Receptor for R-spondins that potentiates the canonical Wnt signaling pathway and is involved in the formation of various organs. Upon binding to R-spondins (RSPO1, RSPO2, RSPO3 or RSPO4), associates with phosphorylated LRP6 and frizzled receptor
PDB 4KT1 , 4QXE , 4QXF , 8WVU , 8WVV , 8WVW , 8WVX , 8WVY , 8XFP , 8XFS , 8XFT , 8XT9 , 8XUM , 8Y69
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01462 LRRNT 29 56 Leucine rich repeat N-terminal domain Family
PF13855 LRR_8 59 117 Leucine rich repeat Repeat
PF13855 LRR_8 105 165 Leucine rich repeat Repeat
PF13855 LRR_8 177 237 Leucine rich repeat Repeat
PF13855 LRR_8 248 307 Leucine rich repeat Repeat
PF13855 LRR_8 319 377 Leucine rich repeat Repeat
PF13855 LRR_8 365 425 Leucine rich repeat Repeat
PF00001 7tm_1 555 801 7 transmembrane receptor (rhodopsin family) Family
Tissue specificity TISSUE SPECIFICITY: Expressed in multiple steroidogenic tissues: placenta, ovary, testis and adrenal. Expressed also in spinal cord, thyroid, stomach, trachea, heart, pancreas, kidney, prostate and spleen.
Sequence
MPGPLGLLCFLALGLLGSAGPSGAAPPLCAAPCSCDGDRRVDCSGKGLTAVPEGLSAFTQ
ALDISMNNITQLPEDAFKNFPFLEELQLAGNDLSFIHPKALSGL
KELKVLTLQNNQLKTV
PSEAIRGLSALQSLRLDANHITSVPEDSFEGLVQLRHLWLDDNSL
TEVPVHPLSNLPTLQ
ALTLALNKISSIPDFAFTNLSSLVVLHLHNNKIRSLSQHCFDGLDNLETLDLNYNNL
GEF
PQAIKALPSLKELGFHSNSISVIPDGAFDGNPLLRTIHLYDNPLSFVGNSAFHNLSDLHS
LVIRGAS
MVQQFPNLTGTVHLESLTLTGTKISSIPNNLCQEQKMLRTLDLSYNNIRDLPS
FNGC
HALEEISLQRNQIYQIKEGTFQGLISLRILDLSRNLIHEIHSRAFATLGPITNLDV
SFNEL
TSFPTEGLNGLNQLKLVGNFKLKEALAAKDFVNLRSLSVPYAYQCCAFWGCDSYA
NLNTEDNSLQDHSVAQEKGTADAANVTSTLENEEHSQIIIHCTPSTGAFKPCEYLLGSWM
IRLTVWFIFLVALFFNLLVILTTFASCTSLPSSKLFIGLISVSNLFMGIYTGILTFLDAV
SWGRFAEFGIWWETGSGCKVAGFLAVFSSESAIFLLMLATVERSLSAKDIMKNGKSNHLK
QFRVAALLAFLGATVAGCFPLFHRGEYSASPLCLPFPTGETPSLGFTVTLVLLNSLAFLL
MAVIYTKLYCNLEKEDLSENSQSSMIKHVAWLIFTNCIFFCPVAFFSFAPLITAISISPE
IMKSVTLIFFPLPACLNPVLY
VFFNPKFKEDWKLLKRRVTKKSGSVSVSISSQGGCLEQD
FYYDCGMYSHLQGNLTVCDCCESFLLTKPVSCKHLIKSHSCPALAVASCQRPEGYWSDCG
TQSAHSDYADEEDSFVSDSSDQVQACGRACFYQSRGFPLVRYAYNLPRVKD
Sequence length 951
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Wnt signaling pathway   Regulation of FZD by ubiquitination
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
12
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Delayed puberty, self-limited Pathogenic rs757351670, rs34804482 RCV001777185
RCV001777186
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
ANDROGENETIC ALOPECIA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Bone mineral density quantitative trait locus 17 association ClinVar
CTD, ClinVar
★★★☆☆
Reported in Unknown/Other Associations (≥2 sources)
Cervical cancer Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Alopecia Alopecia GWASCAT_DG 28196072
★☆☆☆☆
Found in Text Mining only
Aniridia Aniridia BEFREE 24519938
★☆☆☆☆
Found in Text Mining only
Anonychia congenita Anonychia Pubtator 23809763 Associate
★☆☆☆☆
Found in Text Mining only
Aortic Valve Insufficiency Aortic Valve Insufficiency BEFREE 27743893
★☆☆☆☆
Found in Text Mining only
Arthritis Arthritis BEFREE 31486476
★☆☆☆☆
Found in Text Mining only
Autoimmune Diseases Autoimmune Diseases BEFREE 23589304
★☆☆☆☆
Found in Text Mining only
Bicuspid Aortic Valve Disease Bicuspid aortic valve Pubtator 36071494 Associate
★☆☆☆☆
Found in Text Mining only
Bone Diseases Bone disease Pubtator 39525853 Associate
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma BEFREE 29269400
★☆☆☆☆
Found in Text Mining only
Carcinoma Carcinoma BEFREE 17178856
★☆☆☆☆
Found in Text Mining only