Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	55364
Gene name	Impact RWD domain protein
Gene symbol	IMPACT
Synonyms (NCBI Gene)	RWDD5
Chromosome	18
Chromosome location	18q11.2

203

Show/Hide all (203)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022642	hsa-miR-124-3p	Microarray	18668037
MIRT1065818	hsa-miR-1228	CLIP-seq
MIRT1065819	hsa-miR-1255a	CLIP-seq
MIRT1065820	hsa-miR-1255b	CLIP-seq
MIRT1065821	hsa-miR-150	CLIP-seq
MIRT1065822	hsa-miR-1972	CLIP-seq
MIRT1065823	hsa-miR-2053	CLIP-seq
MIRT1065824	hsa-miR-24	CLIP-seq
MIRT1065825	hsa-miR-3135	CLIP-seq
MIRT1065826	hsa-miR-3146	CLIP-seq
MIRT1065827	hsa-miR-3168	CLIP-seq
MIRT1065828	hsa-miR-3171	CLIP-seq
MIRT1065829	hsa-miR-3202	CLIP-seq
MIRT1065830	hsa-miR-330-3p	CLIP-seq
MIRT1065831	hsa-miR-342-3p	CLIP-seq
MIRT1065832	hsa-miR-3622b-5p	CLIP-seq
MIRT1065833	hsa-miR-3671	CLIP-seq
MIRT1065834	hsa-miR-3922-5p	CLIP-seq
MIRT1065835	hsa-miR-3974	CLIP-seq
MIRT1065836	hsa-miR-409-3p	CLIP-seq
MIRT1065837	hsa-miR-4284	CLIP-seq
MIRT1065838	hsa-miR-4511	CLIP-seq
MIRT1065839	hsa-miR-451b	CLIP-seq
MIRT1065840	hsa-miR-4533	CLIP-seq
MIRT1065841	hsa-miR-4645-5p	CLIP-seq
MIRT1065842	hsa-miR-4673	CLIP-seq
MIRT1065843	hsa-miR-4690-5p	CLIP-seq
MIRT1065844	hsa-miR-4713-5p	CLIP-seq
MIRT1065845	hsa-miR-4731-3p	CLIP-seq
MIRT1065846	hsa-miR-4755-3p	CLIP-seq
MIRT1065847	hsa-miR-4781-3p	CLIP-seq
MIRT1065848	hsa-miR-4799-5p	CLIP-seq
MIRT1065849	hsa-miR-4801	CLIP-seq
MIRT1065850	hsa-miR-491-3p	CLIP-seq
MIRT1065851	hsa-miR-493	CLIP-seq
MIRT1065852	hsa-miR-495	CLIP-seq
MIRT1065853	hsa-miR-513a-3p	CLIP-seq
MIRT1065854	hsa-miR-532-3p	CLIP-seq
MIRT1065855	hsa-miR-548ag	CLIP-seq
MIRT1065856	hsa-miR-548ai	CLIP-seq
MIRT1065857	hsa-miR-548m	CLIP-seq
MIRT1065858	hsa-miR-569	CLIP-seq
MIRT1065859	hsa-miR-582-3p	CLIP-seq
MIRT1065860	hsa-miR-606	CLIP-seq
MIRT1065861	hsa-miR-607	CLIP-seq
MIRT1065862	hsa-miR-633	CLIP-seq
MIRT1065863	hsa-miR-7	CLIP-seq
MIRT1065819	hsa-miR-1255a	CLIP-seq
MIRT1065820	hsa-miR-1255b	CLIP-seq
MIRT2015639	hsa-miR-137	CLIP-seq
MIRT2015640	hsa-miR-141	CLIP-seq
MIRT2015641	hsa-miR-200a	CLIP-seq
MIRT2015642	hsa-miR-203	CLIP-seq
MIRT2015643	hsa-miR-3065-3p	CLIP-seq
MIRT2015644	hsa-miR-3117-5p	CLIP-seq
MIRT2015645	hsa-miR-323-3p	CLIP-seq
MIRT2015646	hsa-miR-34b	CLIP-seq
MIRT2015647	hsa-miR-3607-3p	CLIP-seq
MIRT2015648	hsa-miR-3613-3p	CLIP-seq
MIRT2015649	hsa-miR-3675-3p	CLIP-seq
MIRT2015650	hsa-miR-3686	CLIP-seq
MIRT2015651	hsa-miR-3920	CLIP-seq
MIRT2015652	hsa-miR-3935	CLIP-seq
MIRT1065838	hsa-miR-4511	CLIP-seq
MIRT1065839	hsa-miR-451b	CLIP-seq
MIRT2015653	hsa-miR-4652-3p	CLIP-seq
MIRT2015654	hsa-miR-4771	CLIP-seq
MIRT1065847	hsa-miR-4781-3p	CLIP-seq
MIRT1065852	hsa-miR-495	CLIP-seq
MIRT2015655	hsa-miR-513b	CLIP-seq
MIRT2015656	hsa-miR-548n	CLIP-seq
MIRT2015657	hsa-miR-577	CLIP-seq
MIRT1065818	hsa-miR-1228	CLIP-seq
MIRT2248019	hsa-miR-1283	CLIP-seq
MIRT2015639	hsa-miR-137	CLIP-seq
MIRT1065822	hsa-miR-1972	CLIP-seq
MIRT1065824	hsa-miR-24	CLIP-seq
MIRT2248020	hsa-miR-3064-3p	CLIP-seq
MIRT2015644	hsa-miR-3117-5p	CLIP-seq
MIRT1065825	hsa-miR-3135	CLIP-seq
MIRT2248021	hsa-miR-3156-3p	CLIP-seq
MIRT1065829	hsa-miR-3202	CLIP-seq
MIRT2015645	hsa-miR-323-3p	CLIP-seq
MIRT1065831	hsa-miR-342-3p	CLIP-seq
MIRT1065832	hsa-miR-3622b-5p	CLIP-seq
MIRT2248022	hsa-miR-3668	CLIP-seq
MIRT1065834	hsa-miR-3922-5p	CLIP-seq
MIRT1065835	hsa-miR-3974	CLIP-seq
MIRT1065837	hsa-miR-4284	CLIP-seq
MIRT2248023	hsa-miR-4287	CLIP-seq
MIRT2248024	hsa-miR-4301	CLIP-seq
MIRT2248025	hsa-miR-4469	CLIP-seq
MIRT2248026	hsa-miR-450b-5p	CLIP-seq
MIRT1065840	hsa-miR-4533	CLIP-seq
MIRT1065841	hsa-miR-4645-5p	CLIP-seq
MIRT1065842	hsa-miR-4673	CLIP-seq
MIRT2248027	hsa-miR-4685-3p	CLIP-seq
MIRT1065843	hsa-miR-4690-5p	CLIP-seq
MIRT2248028	hsa-miR-4699-3p	CLIP-seq
MIRT2248029	hsa-miR-4715-3p	CLIP-seq
MIRT2248030	hsa-miR-4733-5p	CLIP-seq
MIRT1065846	hsa-miR-4755-3p	CLIP-seq
MIRT2248031	hsa-miR-4776-3p	CLIP-seq
MIRT1065848	hsa-miR-4799-5p	CLIP-seq
MIRT1065851	hsa-miR-493	CLIP-seq
MIRT2248032	hsa-miR-507	CLIP-seq
MIRT1065857	hsa-miR-548m	CLIP-seq
MIRT2248033	hsa-miR-557	CLIP-seq
MIRT2248034	hsa-miR-634	CLIP-seq
MIRT2248035	hsa-miR-642a	CLIP-seq
MIRT1065863	hsa-miR-7	CLIP-seq
MIRT2248036	hsa-miR-766	CLIP-seq
MIRT2015639	hsa-miR-137	CLIP-seq
MIRT2015644	hsa-miR-3117-5p	CLIP-seq
MIRT1065829	hsa-miR-3202	CLIP-seq
MIRT2015645	hsa-miR-323-3p	CLIP-seq
MIRT1065834	hsa-miR-3922-5p	CLIP-seq
MIRT1065835	hsa-miR-3974	CLIP-seq
MIRT1065840	hsa-miR-4533	CLIP-seq
MIRT1065851	hsa-miR-493	CLIP-seq
MIRT1065825	hsa-miR-3135	CLIP-seq
MIRT2451804	hsa-miR-3135b	CLIP-seq
MIRT2451805	hsa-miR-3691-3p	CLIP-seq
MIRT2451806	hsa-miR-4434	CLIP-seq
MIRT2451807	hsa-miR-4487	CLIP-seq
MIRT1065838	hsa-miR-4511	CLIP-seq
MIRT2451808	hsa-miR-4516	CLIP-seq
MIRT1065839	hsa-miR-451b	CLIP-seq
MIRT2451809	hsa-miR-4531	CLIP-seq
MIRT2248036	hsa-miR-766	CLIP-seq
MIRT2551751	hsa-miR-1207-5p	CLIP-seq
MIRT1065818	hsa-miR-1228	CLIP-seq
MIRT1065819	hsa-miR-1255a	CLIP-seq
MIRT1065820	hsa-miR-1255b	CLIP-seq
MIRT2551752	hsa-miR-1285	CLIP-seq
MIRT2551753	hsa-miR-1304	CLIP-seq
MIRT1065823	hsa-miR-2053	CLIP-seq
MIRT2551754	hsa-miR-28-5p	CLIP-seq
MIRT2248020	hsa-miR-3064-3p	CLIP-seq
MIRT2015643	hsa-miR-3065-3p	CLIP-seq
MIRT2551755	hsa-miR-3139	CLIP-seq
MIRT1065826	hsa-miR-3146	CLIP-seq
MIRT2248021	hsa-miR-3156-3p	CLIP-seq
MIRT1065827	hsa-miR-3168	CLIP-seq
MIRT2551756	hsa-miR-3187-5p	CLIP-seq
MIRT2551757	hsa-miR-323b-3p	CLIP-seq
MIRT2015648	hsa-miR-3613-3p	CLIP-seq
MIRT2551758	hsa-miR-3646	CLIP-seq
MIRT2551759	hsa-miR-3667-5p	CLIP-seq
MIRT2551760	hsa-miR-3670	CLIP-seq
MIRT2551761	hsa-miR-376c	CLIP-seq
MIRT2551762	hsa-miR-4276	CLIP-seq
MIRT2248024	hsa-miR-4301	CLIP-seq
MIRT2551763	hsa-miR-4457	CLIP-seq
MIRT2551764	hsa-miR-4668-3p	CLIP-seq
MIRT2551765	hsa-miR-4699-5p	CLIP-seq
MIRT2248029	hsa-miR-4715-3p	CLIP-seq
MIRT2248030	hsa-miR-4733-5p	CLIP-seq
MIRT2551766	hsa-miR-4735-5p	CLIP-seq
MIRT2551767	hsa-miR-4736	CLIP-seq
MIRT2551768	hsa-miR-4763-3p	CLIP-seq
MIRT2248031	hsa-miR-4776-3p	CLIP-seq
MIRT1065847	hsa-miR-4781-3p	CLIP-seq
MIRT2551769	hsa-miR-487a	CLIP-seq
MIRT1065850	hsa-miR-491-3p	CLIP-seq
MIRT1065852	hsa-miR-495	CLIP-seq
MIRT2015655	hsa-miR-513b	CLIP-seq
MIRT2551770	hsa-miR-515-5p	CLIP-seq
MIRT2551771	hsa-miR-520d-5p	CLIP-seq
MIRT2551772	hsa-miR-524-5p	CLIP-seq
MIRT2551773	hsa-miR-548ae	CLIP-seq
MIRT2551774	hsa-miR-548aj	CLIP-seq
MIRT2551775	hsa-miR-548am	CLIP-seq
MIRT1065857	hsa-miR-548m	CLIP-seq
MIRT2551776	hsa-miR-548x	CLIP-seq
MIRT2551777	hsa-miR-556-5p	CLIP-seq
MIRT2551778	hsa-miR-576-5p	CLIP-seq
MIRT2551779	hsa-miR-612	CLIP-seq
MIRT2551780	hsa-miR-661	CLIP-seq
MIRT2551781	hsa-miR-665	CLIP-seq
MIRT2551782	hsa-miR-708	CLIP-seq
MIRT2551751	hsa-miR-1207-5p	CLIP-seq
MIRT1065818	hsa-miR-1228	CLIP-seq
MIRT2551752	hsa-miR-1285	CLIP-seq
MIRT2551753	hsa-miR-1304	CLIP-seq
MIRT2015639	hsa-miR-137	CLIP-seq
MIRT2551754	hsa-miR-28-5p	CLIP-seq
MIRT2015644	hsa-miR-3117-5p	CLIP-seq
MIRT2551755	hsa-miR-3139	CLIP-seq
MIRT2551756	hsa-miR-3187-5p	CLIP-seq
MIRT2015645	hsa-miR-323-3p	CLIP-seq
MIRT2015648	hsa-miR-3613-3p	CLIP-seq
MIRT2551760	hsa-miR-3670	CLIP-seq
MIRT2551761	hsa-miR-376c	CLIP-seq
MIRT2551763	hsa-miR-4457	CLIP-seq
MIRT2551764	hsa-miR-4668-3p	CLIP-seq
MIRT2551767	hsa-miR-4736	CLIP-seq
MIRT2551768	hsa-miR-4763-3p	CLIP-seq
MIRT2015655	hsa-miR-513b	CLIP-seq
MIRT2551779	hsa-miR-612	CLIP-seq
MIRT2551780	hsa-miR-661	CLIP-seq
MIRT2551781	hsa-miR-665	CLIP-seq
MIRT2551782	hsa-miR-708	CLIP-seq

Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS
GO:0003779	Function	Actin binding	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0006417	Process	Regulation of translation	IEA
GO:0006446	Process	Regulation of translational initiation	IBA
GO:0006446	Process	Regulation of translational initiation	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0034198	Process	Cellular response to amino acid starvation	IEA
GO:0034198	Process	Cellular response to amino acid starvation	ISS
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0035556	Process	Intracellular signal transduction	ISS
GO:0043022	Function	Ribosome binding	IEA
GO:0045666	Process	Positive regulation of neuron differentiation	IEA
GO:0045666	Process	Positive regulation of neuron differentiation	ISS
GO:0140311	Function	Protein sequestering activity	IEA
GO:0140311	Function	Protein sequestering activity	ISS
GO:0140469	Process	GCN2-mediated signaling	IBA
GO:0140469	Process	GCN2-mediated signaling	IEA
GO:0140469	Process	GCN2-mediated signaling	ISS
GO:1990138	Process	Neuron projection extension	IEA
GO:1990138	Process	Neuron projection extension	ISS
GO:1990611	Process	Regulation of cytoplasmic translational initiation in response to stress	IEA
GO:1990611	Process	Regulation of cytoplasmic translational initiation in response to stress	ISS

MIM	HGNC	e!Ensembl
615319	20387	ENSG00000154059

Q9P2X3

Protein name

Protein IMPACT (Imprinted and ancient gene protein homolog)

Protein function

Translational regulator that ensures constant high levels of translation upon a variety of stress conditions, such as amino acid starvation, UV-C irradiation, proteasome inhibitor treatment and glucose deprivation. Plays a role as a negative reg

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05773	RWD	10 → 113	RWD domain	Domain
PF01205	UPF0029	182 → 289	Uncharacterized protein family UPF0029	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. Expressed at high level in brain. {ECO:0000269|PubMed:11116084, ECO:0000269|PubMed:11244491}.

Sequence

MAEGDAGSDQRQNEEIEAMAAIYGEEWCVIDDCAKIFCIRISDDIDDPKWTLCLQVMLPN
EYPGTAPPIYQLNAPWLKGQERADLSNSLEEIYIQNIGESILYLWVEKIRDVLIQKSQMT
EPGPDVKKKTEEEDVECEDDLILACQPESSLKALDFDISETRTEVEVEELPPIDHGIPIT
DRRSTFQAHLAPVVCPKQVKMVLSKLYENKKIASATHNIYAYRIYCEDKQTFLQDCEDDG
ETAAGGRLLHLMEILNVKNVMVVVSRWYGGILLGPDRFKHINNCARNILVEKNYTNSPEE
SSKALGKNKKVRKDKKRNEH

Sequence length

320

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BIPOLAR DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR AFFECTIVE DISORDER 2	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NASOPHARYNGEAL NEOPLASM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (57)

Disease Name	Disease (Merged)	Source	PMID	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	30912628	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	30912628	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	29615459	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aphasia	Aphasia	BEFREE	27917691	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	27457512	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	28449686	★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	26935821, 28429656, 31068890	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	11244491	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	11244491	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma of lung	Lung carcinoma	BEFREE	26960398	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	27822742, 28566311, 28617815, 29108929, 29634725, 30982338	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	30653386	★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	30912628	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	31281061, 31819401	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	27022117, 27248473	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital heart disease	Congenital Heart Disease	BEFREE	28116865, 29762234	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	29264937	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	30995272	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	27470433, 28169974	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	30486802, 31651667	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	30041685, 30289310, 31805349	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	30041685, 30289310, 31805349	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	29949015, 30982338, 31805349	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	29762234	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	29264937	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia	BEFREE	31571840	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	30041685, 31181144	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	27470433, 28169974, 29032599, 29688466, 29998507, 31651667	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	31133406	★★★★★ ★☆☆☆☆ Found in Text Mining only
Learning Disorders	Learning Disorders	BEFREE	28666316	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	29320973	★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 1	Major Affective Disorder	BEFREE	11244491	★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	BEFREE	11244491	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	PSYGENET_DG	11244491	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR AFFECTIVE DISORDER 4	Major Affective Disorder	BEFREE	11244491	★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 6	Major Affective Disorder	BEFREE	11244491	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30158597	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	17309171, 20840664, 24484606, 28697982, 29301143, 31537406	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30950162	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24212499, 28584132, 29496399, 29615459, 29656758, 29758342, 30178746, 30406144, 30730411, 31191524, 31360969	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	30486802, 31651667	★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	31842054	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	26556299, 29697364, 29976496, 30406144, 30643016, 30643254, 31417090, 31471310	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	29127119	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	31166980	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	30515649	★★★★★ ★☆☆☆☆ Found in Text Mining only
Phyllodes Tumor	Phyllodes Tumor	BEFREE	26832993	★★★★★ ★☆☆☆☆ Found in Text Mining only
Portal Hypertension	Portal Hypertension	BEFREE	27878906	★★★★★ ★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	30541492	★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	30912628	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	17309171, 20840664, 24484606, 28697982, 29301143, 31537406	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhegmatogenous retinal detachment	Rhegmatogenous retinal detachment	BEFREE	29190237	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	31006511	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	30719217	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Erosion	Skin Erosion	BEFREE	28116865	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30950162	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	27470433	★★★★★ ★☆☆☆☆ Found in Text Mining only

IMPACT (impact RWD domain protein)