Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5536
Gene name	Protein phosphatase 5 catalytic subunit
Gene symbol	PPP5C
Synonyms (NCBI Gene)	PP5PPP5PPT
Chromosome	19
Chromosome location	19q13.32
Summary	This gene encodes a serine/threonine phosphatase which is a member of the protein phosphatase catalytic subunit family. Proteins in this family participate in pathways regulated by reversible phosphorylation at serine and threonine residues; many of these

112

Show/Hide all (112)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001518	hsa-miR-155-5p	pSILAC	18668040
MIRT039894	hsa-miR-615-3p	CLASH	23622248
MIRT039894	hsa-miR-615-3p	CLASH	23622248
MIRT038528	hsa-miR-99b-3p	CLASH	23622248
MIRT1258599	hsa-miR-4286	CLIP-seq
MIRT2076213	hsa-miR-1913	CLIP-seq
MIRT2076214	hsa-miR-3162-3p	CLIP-seq
MIRT2076215	hsa-miR-3183	CLIP-seq
MIRT2076216	hsa-miR-324-3p	CLIP-seq
MIRT2076217	hsa-miR-345	CLIP-seq
MIRT2076218	hsa-miR-4522	CLIP-seq
MIRT2076219	hsa-miR-4723-3p	CLIP-seq
MIRT2076220	hsa-miR-4732-3p	CLIP-seq
MIRT2076221	hsa-miR-4749-3p	CLIP-seq
MIRT2302803	hsa-miR-1207-5p	CLIP-seq
MIRT2302804	hsa-miR-3131	CLIP-seq
MIRT2302805	hsa-miR-365	CLIP-seq
MIRT1258599	hsa-miR-4286	CLIP-seq
MIRT2302806	hsa-miR-4436b-3p	CLIP-seq
MIRT2302807	hsa-miR-4632	CLIP-seq
MIRT2302808	hsa-miR-4758-3p	CLIP-seq
MIRT2302809	hsa-miR-4763-3p	CLIP-seq
MIRT2302810	hsa-miR-486-3p	CLIP-seq
MIRT2302811	hsa-miR-611	CLIP-seq
MIRT2599482	hsa-miR-1273e	CLIP-seq
MIRT2599483	hsa-miR-1275	CLIP-seq
MIRT2599484	hsa-miR-137	CLIP-seq
MIRT2599485	hsa-miR-146b-3p	CLIP-seq
MIRT2599486	hsa-miR-1908	CLIP-seq
MIRT2076213	hsa-miR-1913	CLIP-seq
MIRT2599487	hsa-miR-193a-5p	CLIP-seq
MIRT2599488	hsa-miR-2276	CLIP-seq
MIRT2599489	hsa-miR-2861	CLIP-seq
MIRT2599490	hsa-miR-3157-3p	CLIP-seq
MIRT2076214	hsa-miR-3162-3p	CLIP-seq
MIRT2599491	hsa-miR-3173-5p	CLIP-seq
MIRT2599492	hsa-miR-3180	CLIP-seq
MIRT2599493	hsa-miR-3180-3p	CLIP-seq
MIRT2076215	hsa-miR-3183	CLIP-seq
MIRT2599494	hsa-miR-3194-3p	CLIP-seq
MIRT2599495	hsa-miR-3196	CLIP-seq
MIRT2076216	hsa-miR-324-3p	CLIP-seq
MIRT2599496	hsa-miR-326	CLIP-seq
MIRT2599497	hsa-miR-330-5p	CLIP-seq
MIRT2599498	hsa-miR-337-3p	CLIP-seq
MIRT2599499	hsa-miR-3973	CLIP-seq
MIRT2599500	hsa-miR-4292	CLIP-seq
MIRT2599501	hsa-miR-4317	CLIP-seq
MIRT2599502	hsa-miR-4447	CLIP-seq
MIRT2599503	hsa-miR-4472	CLIP-seq
MIRT2599504	hsa-miR-4481	CLIP-seq
MIRT2599505	hsa-miR-4509	CLIP-seq
MIRT2076218	hsa-miR-4522	CLIP-seq
MIRT2599506	hsa-miR-4525	CLIP-seq
MIRT2599507	hsa-miR-4640-3p	CLIP-seq
MIRT2599508	hsa-miR-4658	CLIP-seq
MIRT2599509	hsa-miR-4665-5p	CLIP-seq
MIRT2599510	hsa-miR-4667-5p	CLIP-seq
MIRT2599511	hsa-miR-4700-5p	CLIP-seq
MIRT2076219	hsa-miR-4723-3p	CLIP-seq
MIRT2599512	hsa-miR-4723-5p	CLIP-seq
MIRT2599513	hsa-miR-4725-5p	CLIP-seq
MIRT2599514	hsa-miR-4745-5p	CLIP-seq
MIRT2076221	hsa-miR-4749-3p	CLIP-seq
MIRT2599515	hsa-miR-4758-5p	CLIP-seq
MIRT2599516	hsa-miR-4772-3p	CLIP-seq
MIRT2599517	hsa-miR-504	CLIP-seq
MIRT2599518	hsa-miR-520d-5p	CLIP-seq
MIRT2599519	hsa-miR-524-5p	CLIP-seq
MIRT2599520	hsa-miR-548a-5p	CLIP-seq
MIRT2599521	hsa-miR-548ab	CLIP-seq
MIRT2599522	hsa-miR-548ak	CLIP-seq
MIRT2599523	hsa-miR-548b-5p	CLIP-seq
MIRT2599524	hsa-miR-548c-5p	CLIP-seq
MIRT2599525	hsa-miR-548d-5p	CLIP-seq
MIRT2599526	hsa-miR-548h	CLIP-seq
MIRT2599527	hsa-miR-548i	CLIP-seq
MIRT2599528	hsa-miR-548j	CLIP-seq
MIRT2599529	hsa-miR-548w	CLIP-seq
MIRT2599530	hsa-miR-548y	CLIP-seq
MIRT2599531	hsa-miR-559	CLIP-seq
MIRT2599532	hsa-miR-615-5p	CLIP-seq
MIRT2599533	hsa-miR-625	CLIP-seq
MIRT2599534	hsa-miR-637	CLIP-seq
MIRT2599535	hsa-miR-652	CLIP-seq
MIRT2599536	hsa-miR-663	CLIP-seq
MIRT2599537	hsa-miR-744	CLIP-seq
MIRT2599538	hsa-miR-874	CLIP-seq
MIRT2076213	hsa-miR-1913	CLIP-seq
MIRT2599488	hsa-miR-2276	CLIP-seq
MIRT2076214	hsa-miR-3162-3p	CLIP-seq
MIRT2076216	hsa-miR-324-3p	CLIP-seq
MIRT2599499	hsa-miR-3973	CLIP-seq
MIRT2599505	hsa-miR-4509	CLIP-seq
MIRT2076218	hsa-miR-4522	CLIP-seq
MIRT2599507	hsa-miR-4640-3p	CLIP-seq
MIRT2076221	hsa-miR-4749-3p	CLIP-seq
MIRT2599516	hsa-miR-4772-3p	CLIP-seq
MIRT2599518	hsa-miR-520d-5p	CLIP-seq
MIRT2599519	hsa-miR-524-5p	CLIP-seq
MIRT2599520	hsa-miR-548a-5p	CLIP-seq
MIRT2599521	hsa-miR-548ab	CLIP-seq
MIRT2599522	hsa-miR-548ak	CLIP-seq
MIRT2599523	hsa-miR-548b-5p	CLIP-seq
MIRT2599524	hsa-miR-548c-5p	CLIP-seq
MIRT2599525	hsa-miR-548d-5p	CLIP-seq
MIRT2599526	hsa-miR-548h	CLIP-seq
MIRT2599527	hsa-miR-548i	CLIP-seq
MIRT2599528	hsa-miR-548j	CLIP-seq
MIRT2599529	hsa-miR-548w	CLIP-seq
MIRT2599530	hsa-miR-548y	CLIP-seq
MIRT2599531	hsa-miR-559	CLIP-seq

Show/Hide all (61)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	TAS
GO:0000278	Process	Mitotic cell cycle	TAS	7925273
GO:0001965	Function	G-protein alpha-subunit binding	IEA
GO:0003723	Function	RNA binding	IEA
GO:0004721	Function	Phosphoprotein phosphatase activity	IEA
GO:0004721	Function	Phosphoprotein phosphatase activity	ISS	9383998
GO:0004721	Function	Phosphoprotein phosphatase activity	TAS	28386764
GO:0004722	Function	Protein serine/threonine phosphatase activity	IBA
GO:0004722	Function	Protein serine/threonine phosphatase activity	IDA	30699359
GO:0004722	Function	Protein serine/threonine phosphatase activity	IEA
GO:0004722	Function	Protein serine/threonine phosphatase activity	ISS	15546861
GO:0004722	Function	Protein serine/threonine phosphatase activity	TAS	7925273, 15546861, 16262633
GO:0005515	Function	Protein binding	IPI	9383998, 11504734, 14764652, 16531226, 16790549, 19875381, 21360678, 25036637, 26496610, 27353360, 27880917, 28330616, 30699359, 33961781, 35271311
GO:0005524	Function	ATP binding	IDA	23184943
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	7925273
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0006281	Process	DNA repair	IEA
GO:0006302	Process	Double-strand break repair	TAS
GO:0006351	Process	DNA-templated transcription	TAS	7925273
GO:0006974	Process	DNA damage response	IEA
GO:0008017	Function	Microtubule binding	IEA
GO:0008289	Function	Lipid binding	IEA
GO:0010288	Process	Response to lead ion	IEA
GO:0010288	Process	Response to lead ion	ISS
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016791	Function	Phosphatase activity	IDA	15546861
GO:0030291	Function	Protein serine/threonine kinase inhibitor activity	IEA
GO:0030544	Function	Hsp70 protein binding	IEA
GO:0031072	Function	Heat shock protein binding	IEA
GO:0031435	Function	Mitogen-activated protein kinase kinase kinase binding	IEA
GO:0032991	Component	Protein-containing complex	IDA	23184943
GO:0042802	Function	Identical protein binding	IPI	21360678
GO:0043025	Component	Neuronal cell body	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	HMP	12761501
GO:0043204	Component	Perikaryon	IEA
GO:0043278	Process	Response to morphine	IEA
GO:0043409	Process	Negative regulation of MAPK cascade	IEA
GO:0043531	Function	ADP binding	IDA	23184943
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048156	Function	Tau protein binding	NAS	28386764
GO:0051879	Function	Hsp90 protein binding	IEA
GO:0051879	Function	Hsp90 protein binding	IPI	15713458
GO:0070262	Process	Peptidyl-serine dephosphorylation	IDA	30699359
GO:0070301	Process	Cellular response to hydrogen peroxide	IEA
GO:0071276	Process	Cellular response to cadmium ion	IEA
GO:0101031	Component	Protein folding chaperone complex	IDA	29127155
GO:1904550	Process	Response to arachidonate	IEA
GO:1904550	Process	Response to arachidonate	ISS	15546861
GO:1990635	Component	Proximal dendrite	IEA
GO:2000324	Process	Positive regulation of nuclear receptor-mediated glucocorticoid signaling pathway	IEA

MIM	HGNC	e!Ensembl
600658	9322	ENSG00000011485

P53041

Protein name

Serine/threonine-protein phosphatase 5 (PP5) (EC 3.1.3.16) (Protein phosphatase T) (PP-T) (PPT)

Protein function

Serine/threonine-protein phosphatase that dephosphorylates a myriad of proteins involved in different signaling pathways including the kinases CSNK1E, ASK1/MAP3K5, PRKDC and RAF1, the nuclear receptors NR3C1, PPARG, ESR1 and ESR2, SMAD proteins

PDB

1A17 , 1S95 , 1WAO , 2BUG , 3H60 , 3H61 , 3H62 , 3H63 , 3H64 , 3H66 , 3H67 , 3H68 , 3H69 , 4ZVZ , 4ZX2 , 5HPE , 5UI1 , 5WG8 , 7ZR5 , 7ZR6 , 8GAE , 8GFT

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00515	TPR_1	28 → 61	Tetratricopeptide repeat	Repeat
PF08321	PPP5	136 → 228	PPP5 TPR repeat region	Family
PF00149	Metallophos	235 → 431	Calcineurin-like phosphoesterase	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:15546861}.

Sequence

MAMAEGERTECAEPPRDEPPADGALKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPS
NAIYYGNRSLAYLRTECYGYALGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYE
TVVKVKPHDKDAKMKYQECNKIVKQKAFERAIAGDEHKRSVVDSLDIESMTIEDEYSGPK
LEDGKVTISFMKELMQWYKDQKKLHRKCAYQILVQVKEVLSKLSTLVETTLKETEKITVC
GDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLL
RGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVFEWLPLAQCINGKVLIMHGGLFSEDG
VTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQNGRSISKRGVSCQFGPDVTKAFLEENNL
DYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQGSDLRPQFHQFTAVP
HPNVKPMAYANTLLQLGMM

Sequence length

499

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway		Negative regulation of MAPK pathway Recruitment and ATM-mediated phosphorylation of repair and signaling proteins at DNA double strand breaks ESR-mediated signaling

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PPP5C-related disorder	Uncertain significance; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (43)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Actinic keratosis	Actinic keratosis	BEFREE	27518833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	21379379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	27501780	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	28534961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	27755948		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	11331294	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28453226	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	28534961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	29141220	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ceroid lipofuscinosis, neuronal 1, infantile	Neuronal ceroid lipofuscinosis	BEFREE	10231585, 10416973, 22387303		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	29797403		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	38302916	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	15004035	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	30376877		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	26453052		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	25796168		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	25796168	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid receptor deficiency/resistance	Pubtator	27742828	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	30289300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	30376877		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infantile neuronal ceroid lipofuscinosis	Neuronal Ceroid Lipofuscinosis	BEFREE	10231585, 10416973, 22387303, 9151310		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	29141220	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	27755948		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	25326185, 27755948		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	27755948		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	29805615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	16052227, 17053814, 18188185, 24649837, 24849040, 30254472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	28534961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29805615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	18280813		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16052227, 24849040, 28534961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	11020216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	8895569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuronal Ceroid-Lipofuscinoses	Neuronal Ceroid Lipofuscinosis	BEFREE	10191107		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30876460		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oral Ulcer	Oral Ulcer	GWASCAT_DG	30837455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	28090608	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	29341930		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	29805615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	33270085	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	17968170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	27603705		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	16052227, 17053814, 18188185, 24649837, 24849040, 30254472		★★★★★ ★☆☆☆☆ Found in Text Mining only

PPP5C (protein phosphatase 5 catalytic subunit)