COPRS (coordinator of PRMT5 and differentiation stimulator)

Gene

• Entrez ID: 55352
• Gene name: Coordinator of PRMT5 and differentiation stimulator
• Gene symbol: COPRS
• Synonyms (NCBI Gene): C17orf79, COPR5, HSA272196, TTP1
• Chromosome: 17
• Chromosome location: 17q11.2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016471	hsa-miR-193b-3p	Microarray	20304954
MIRT039412	hsa-miR-421	CLASH	23622248
MIRT447094	hsa-miR-4311	PAR-CLIP	22100165
MIRT447093	hsa-miR-4524b-3p	PAR-CLIP	22100165
MIRT447091	hsa-miR-7161-3p	PAR-CLIP	22100165
MIRT447092	hsa-miR-6124	PAR-CLIP	22100165
MIRT447094	hsa-miR-4311	PAR-CLIP	22100165
MIRT447093	hsa-miR-4524b-3p	PAR-CLIP	22100165
MIRT447091	hsa-miR-7161-3p	PAR-CLIP	22100165
MIRT447092	hsa-miR-6124	PAR-CLIP	22100165
MIRT447094	hsa-miR-4311	PAR-CLIP	22100165
MIRT447093	hsa-miR-4524b-3p	PAR-CLIP	22100165
MIRT447091	hsa-miR-7161-3p	PAR-CLIP	22100165
MIRT447092	hsa-miR-6124	PAR-CLIP	22100165
MIRT447094	hsa-miR-4311	PAR-CLIP	22100165
MIRT447093	hsa-miR-4524b-3p	PAR-CLIP	22100165
MIRT447091	hsa-miR-7161-3p	PAR-CLIP	22100165
MIRT447092	hsa-miR-6124	PAR-CLIP	22100165

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	18404153, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	18404153
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA
GO:0006325	Process	Chromatin organization	IEA
GO:0006338	Process	Chromatin remodeling	IDA	18404153
GO:0007517	Process	Muscle organ development	IEA
GO:0007517	Process	Muscle organ development	ISS
GO:0042393	Function	Histone binding	IBA
GO:0042393	Function	Histone binding	IDA	18404153
GO:0042393	Function	Histone binding	IEA

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: Q9NQ92
• Protein name: Coordinator of PRMT5 and differentiation stimulator (Cooperator of PRMT5) (Protein TTP1)
• Protein function: Histone-binding protein required for histone H4 methyltransferase activity of PRMT5. Specifically required for histone H4 'Arg-3' methylation mediated by PRMT5, but not histone H3 'Arg-8' methylation, suggesting that it modulates the substrate s
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15340	COPR5	34 → 184	Cooperator of PRMT5 family	Family

• Sequence:

  MDLQAAGAQAQGAAEPSRGPPLPSARGAPPSPEAGFATADHSSQERETEKAMDRLARGTQ
  SIPNDSPARGEGTHSEEEGFAMDEEDSDGELNTWELSEGTNCPPKEQPGDLFNEDWDSEL
  KADQGNPYDADDIQESISQELKPWVCCAPQGDMIYDPSWHHPPPLIPYYSKMVFETGQFD
  DAED

• Sequence length: 184

Pathways

Reactome:

RMTs methylate histone arginines

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Ataxia with vitamin E deficiency	Friedreich Ataxia	BEFREE	15065857		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	11468690	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	20844836		★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	20844836	Stimulate	★☆☆☆☆ Found in Text Mining only