Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	55351
Gene name	Serine/threonine kinase 32B
Gene symbol	STK32B
Synonyms (NCBI Gene)	HSA250839STK32STKG6YANK2
Chromosome	4
Chromosome location	4p16.2
Summary	This gene encodes a serine-threonine protein kinase. Serine-threonine kinases transfer phosphate molecules to the oxygen atoms of serine and threonine. A genomic deletion affecting this gene has been associated with Ellis-van Creveld syndrome, an autosoma

Show/Hide all (66)

miRTarBase ID	miRNA	Experiments
MIRT1397684	hsa-miR-1231	CLIP-seq
MIRT1397685	hsa-miR-3127-5p	CLIP-seq
MIRT1397686	hsa-miR-3164	CLIP-seq
MIRT1397687	hsa-miR-3619-3p	CLIP-seq
MIRT1397688	hsa-miR-3671	CLIP-seq
MIRT1397689	hsa-miR-3918	CLIP-seq
MIRT1397690	hsa-miR-4288	CLIP-seq
MIRT1397691	hsa-miR-4477a	CLIP-seq
MIRT1397692	hsa-miR-4649-3p	CLIP-seq
MIRT1397693	hsa-miR-4738-3p	CLIP-seq
MIRT1397694	hsa-miR-4769-3p	CLIP-seq
MIRT1397695	hsa-miR-583	CLIP-seq
MIRT1397696	hsa-miR-607	CLIP-seq
MIRT1397697	hsa-miR-632	CLIP-seq
MIRT2119067	hsa-miR-1238	CLIP-seq
MIRT2119068	hsa-miR-1271	CLIP-seq
MIRT2119069	hsa-miR-1273d	CLIP-seq
MIRT2119070	hsa-miR-145	CLIP-seq
MIRT2119071	hsa-miR-182	CLIP-seq
MIRT2119072	hsa-miR-3140-5p	CLIP-seq
MIRT2119073	hsa-miR-4267	CLIP-seq
MIRT2119074	hsa-miR-4691-5p	CLIP-seq
MIRT2119075	hsa-miR-548an	CLIP-seq
MIRT2119076	hsa-miR-660	CLIP-seq
MIRT2119077	hsa-miR-665	CLIP-seq
MIRT2119078	hsa-miR-96	CLIP-seq
MIRT1397684	hsa-miR-1231	CLIP-seq
MIRT2341381	hsa-miR-1267	CLIP-seq
MIRT2341382	hsa-miR-15a	CLIP-seq
MIRT2341383	hsa-miR-15b	CLIP-seq
MIRT2341384	hsa-miR-16	CLIP-seq
MIRT2341385	hsa-miR-1910	CLIP-seq
MIRT2341386	hsa-miR-195	CLIP-seq
MIRT1397686	hsa-miR-3164	CLIP-seq
MIRT2341387	hsa-miR-424	CLIP-seq
MIRT1397690	hsa-miR-4288	CLIP-seq
MIRT2341388	hsa-miR-4468	CLIP-seq
MIRT1397692	hsa-miR-4649-3p	CLIP-seq
MIRT2341389	hsa-miR-497	CLIP-seq
MIRT2341390	hsa-miR-595	CLIP-seq
MIRT1397697	hsa-miR-632	CLIP-seq
MIRT2119077	hsa-miR-665	CLIP-seq
MIRT2460681	hsa-miR-186	CLIP-seq
MIRT2460682	hsa-miR-3133	CLIP-seq
MIRT2460683	hsa-miR-3144-5p	CLIP-seq
MIRT2460684	hsa-miR-3191	CLIP-seq
MIRT2460685	hsa-miR-4652-5p	CLIP-seq
MIRT2460686	hsa-miR-548t	CLIP-seq
MIRT2460681	hsa-miR-186	CLIP-seq
MIRT2460682	hsa-miR-3133	CLIP-seq
MIRT2460683	hsa-miR-3144-5p	CLIP-seq
MIRT2460684	hsa-miR-3191	CLIP-seq
MIRT2635385	hsa-miR-4323	CLIP-seq
MIRT2635386	hsa-miR-4520a-3p	CLIP-seq
MIRT2460685	hsa-miR-4652-5p	CLIP-seq
MIRT2635387	hsa-miR-4802-3p	CLIP-seq
MIRT2460686	hsa-miR-548t	CLIP-seq
MIRT2460681	hsa-miR-186	CLIP-seq
MIRT2460682	hsa-miR-3133	CLIP-seq
MIRT2460683	hsa-miR-3144-5p	CLIP-seq
MIRT2460684	hsa-miR-3191	CLIP-seq
MIRT2635385	hsa-miR-4323	CLIP-seq
MIRT2635386	hsa-miR-4520a-3p	CLIP-seq
MIRT2460685	hsa-miR-4652-5p	CLIP-seq
MIRT2635387	hsa-miR-4802-3p	CLIP-seq
MIRT2460686	hsa-miR-548t	CLIP-seq

Show/Hide all (10)

GO ID	Ontology	Definition	Evidence
GO:0000166	Function	Nucleotide binding	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0005524	Function	ATP binding	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0106310	Function	Protein serine kinase activity	IEA

MIM	HGNC	e!Ensembl
621309	14217	ENSG00000152953

Q9NY57

Protein name

Serine/threonine-protein kinase 32B (EC 2.7.11.1) (Yet another novel kinase 2)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	23 → 283	Protein kinase domain	Domain

Sequence

MGGNHSHKPPVFDENEEVNFDHFQILRAIGKGSFGKVCIVQKRDTKKMYAMKYMNKQKCI
ERDEVRNVFRELQIMQGLEHPFLVNLWYSFQDEEDMFMVVDLLLGGDLRYHLQQNVHFTE
GTVKLYICELALALEYLQRYHIIHRDIKPDNILLDEHGHVHITDFNIATVVKGAERASSM
AGTKPYMAPEVFQVYMDRGPGYSYPVDWWSLGITAYELLRGWRPYEIHSVTPIDEILNMF
KVERVHYSSTWCKGMVALLRKLLTKDPESRVSSLHDIQSVPYLADMNWDAVFKKALMPGF
VPNKGRLNCDPTFELEEMILESKPLHKKKKRLAKNRSRDGTKDSCPLNGHLQHCLETVRE
EFIIFNREKLRRQQGQGSQLLDTDSRGGGQAQSKLQDGCNNNLLTHTCTRGCSS

Sequence length

414

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CELIAC DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESSENTIAL TREMOR	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Long QT syndrome	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPERMATOCELE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (18)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer`s Disease	Alzheimer disease	GWASDB_DG	23535033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	GWASCAT_DG	23535033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35800238	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Lip	Cleft lip	Pubtator	20087401	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Lip with or without Cleft Palate	Cleft Lip With Or Without Cleft Palate	BEFREE	20087401		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	20087401	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	21626137	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	GWASDB_DG	21626137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ellis-Van Creveld Syndrome	Ellis-Van Creveld Syndrome	BEFREE	18454448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Tremor	Tremor	BEFREE	27797806, 28801652		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Essential Tremor	Tremor	GWASCAT_DG	27797806		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Essential Tremor	Essential tremor	Pubtator	27797806, 28801652	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Essential Tremor	Essential tremor	Pubtator	28801652	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24885002		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Mild Mental Retardation	Mental retardation	BEFREE	18454448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	24885002		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of mouth	Oral cavity carcinoma	BEFREE	24885002		★★★★★ ★☆☆☆☆ Found in Text Mining only

STK32B (serine/threonine kinase 32B)