Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	55343
Gene name	Solute carrier family 35 member C1
Gene symbol	SLC35C1
Synonyms (NCBI Gene)	CDG2CFUCT1
Chromosome	11
Chromosome location	11p11.2
Summary	This gene encodes a GDP-fucose transporter that is found in the Golgi apparatus. Mutations in this gene result in congenital disorder of glycosylation type IIc. Multiple transcript variants encoding different isoforms have been found for this gene. [provi

Show/Hide all (8)

SNP ID	Visualize variation	Clinical significance	Consequence
rs28937886	C>G	Pathogenic	Coding sequence variant, missense variant, genic downstream transcript variant
rs28939087	C>T	Pathogenic	Coding sequence variant, missense variant, genic upstream transcript variant
rs111773874	G>A	Conflicting-interpretations-of-pathogenicity	Genic downstream transcript variant, coding sequence variant, synonymous variant
rs398124345	G>A,T	Pathogenic	Missense variant, stop gained, coding sequence variant, genic upstream transcript variant
rs587777655	TCT>-	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, genic upstream transcript variant, inframe deletion
rs751828447	C>G,T	Likely-pathogenic	Genic downstream transcript variant, coding sequence variant, missense variant
rs766512058	C>G	Likely-pathogenic	Coding sequence variant, stop gained, genic downstream transcript variant
rs1554953926	C>A	Likely-pathogenic	Coding sequence variant, missense variant, genic downstream transcript variant

195

Show/Hide all (195)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029512	hsa-miR-26b-5p	Microarray	19088304
MIRT052607	hsa-let-7a-5p	CLASH	23622248
MIRT059171	hsa-miR-30a-5p	HITS-CLIP	22473208
MIRT059175	hsa-miR-30b-5p	HITS-CLIP	22473208
MIRT059172	hsa-miR-30c-5p	HITS-CLIP	22473208
MIRT059173	hsa-miR-30d-5p	HITS-CLIP	22473208
MIRT059178	hsa-miR-30e-5p	HITS-CLIP	22473208
MIRT1360492	hsa-miR-1271	CLIP-seq
MIRT1360493	hsa-miR-1273d	CLIP-seq
MIRT1360494	hsa-miR-1294	CLIP-seq
MIRT1360495	hsa-miR-141	CLIP-seq
MIRT1360496	hsa-miR-182	CLIP-seq
MIRT1360497	hsa-miR-200a	CLIP-seq
MIRT1360498	hsa-miR-205	CLIP-seq
MIRT1360499	hsa-miR-30a	CLIP-seq
MIRT1360500	hsa-miR-30b	CLIP-seq
MIRT1360501	hsa-miR-30c	CLIP-seq
MIRT1360502	hsa-miR-30d	CLIP-seq
MIRT1360503	hsa-miR-30e	CLIP-seq
MIRT1360504	hsa-miR-3123	CLIP-seq
MIRT1360505	hsa-miR-3145-3p	CLIP-seq
MIRT1360506	hsa-miR-3154	CLIP-seq
MIRT1360507	hsa-miR-3184	CLIP-seq
MIRT1360508	hsa-miR-3192	CLIP-seq
MIRT1360509	hsa-miR-3199	CLIP-seq
MIRT1360510	hsa-miR-331-3p	CLIP-seq
MIRT1360511	hsa-miR-3925-5p	CLIP-seq
MIRT1360512	hsa-miR-423-5p	CLIP-seq
MIRT1360513	hsa-miR-4292	CLIP-seq
MIRT1360514	hsa-miR-4314	CLIP-seq
MIRT1360515	hsa-miR-4316	CLIP-seq
MIRT1360516	hsa-miR-4450	CLIP-seq
MIRT1360517	hsa-miR-4490	CLIP-seq
MIRT1360518	hsa-miR-4515	CLIP-seq
MIRT1360519	hsa-miR-4530	CLIP-seq
MIRT1360520	hsa-miR-4646-5p	CLIP-seq
MIRT1360521	hsa-miR-4652-5p	CLIP-seq
MIRT1360522	hsa-miR-4667-5p	CLIP-seq
MIRT1360523	hsa-miR-4686	CLIP-seq
MIRT1360524	hsa-miR-4700-5p	CLIP-seq
MIRT1360525	hsa-miR-4762-3p	CLIP-seq
MIRT1360526	hsa-miR-4774-5p	CLIP-seq
MIRT1360527	hsa-miR-646	CLIP-seq
MIRT1360528	hsa-miR-891b	CLIP-seq
MIRT1360529	hsa-miR-96	CLIP-seq
MIRT1360530	hsa-miR-1185	CLIP-seq
MIRT1360531	hsa-miR-1224-5p	CLIP-seq
MIRT1360532	hsa-miR-1227	CLIP-seq
MIRT1360533	hsa-miR-1237	CLIP-seq
MIRT1360534	hsa-miR-124	CLIP-seq
MIRT1360535	hsa-miR-1246	CLIP-seq
MIRT1360536	hsa-miR-1248	CLIP-seq
MIRT1360537	hsa-miR-1266	CLIP-seq
MIRT1360538	hsa-miR-1273e	CLIP-seq
MIRT1360539	hsa-miR-1286	CLIP-seq
MIRT1360540	hsa-miR-1293	CLIP-seq
MIRT1360495	hsa-miR-141	CLIP-seq
MIRT1360541	hsa-miR-193a-5p	CLIP-seq
MIRT1360497	hsa-miR-200a	CLIP-seq
MIRT1360542	hsa-miR-2113	CLIP-seq
MIRT1360543	hsa-miR-218	CLIP-seq
MIRT1360544	hsa-miR-29a	CLIP-seq
MIRT1360545	hsa-miR-29b	CLIP-seq
MIRT1360546	hsa-miR-29c	CLIP-seq
MIRT1360547	hsa-miR-3127-5p	CLIP-seq
MIRT1360548	hsa-miR-3130-5p	CLIP-seq
MIRT1360549	hsa-miR-3179	CLIP-seq
MIRT1360510	hsa-miR-331-3p	CLIP-seq
MIRT1360550	hsa-miR-3605-5p	CLIP-seq
MIRT1360551	hsa-miR-3679-5p	CLIP-seq
MIRT1360552	hsa-miR-3915	CLIP-seq
MIRT1360553	hsa-miR-3918	CLIP-seq
MIRT1360554	hsa-miR-3920	CLIP-seq
MIRT1360555	hsa-miR-4252	CLIP-seq
MIRT1360513	hsa-miR-4292	CLIP-seq
MIRT1360556	hsa-miR-4436a	CLIP-seq
MIRT1360516	hsa-miR-4450	CLIP-seq
MIRT1360557	hsa-miR-4482	CLIP-seq
MIRT1360558	hsa-miR-4483	CLIP-seq
MIRT1360559	hsa-miR-4518	CLIP-seq
MIRT1360519	hsa-miR-4530	CLIP-seq
MIRT1360560	hsa-miR-455-3p	CLIP-seq
MIRT1360561	hsa-miR-4640-5p	CLIP-seq
MIRT1360522	hsa-miR-4667-5p	CLIP-seq
MIRT1360523	hsa-miR-4686	CLIP-seq
MIRT1360562	hsa-miR-4689	CLIP-seq
MIRT1360524	hsa-miR-4700-5p	CLIP-seq
MIRT1360563	hsa-miR-4726-5p	CLIP-seq
MIRT1360525	hsa-miR-4762-3p	CLIP-seq
MIRT1360564	hsa-miR-4778-5p	CLIP-seq
MIRT1360565	hsa-miR-4796-5p	CLIP-seq
MIRT1360566	hsa-miR-506	CLIP-seq
MIRT1360567	hsa-miR-509-3p	CLIP-seq
MIRT1360568	hsa-miR-510	CLIP-seq
MIRT1360569	hsa-miR-513c	CLIP-seq
MIRT1360570	hsa-miR-514b-5p	CLIP-seq
MIRT1360571	hsa-miR-552	CLIP-seq
MIRT1360572	hsa-miR-562	CLIP-seq
MIRT1360573	hsa-miR-630	CLIP-seq
MIRT1360574	hsa-miR-636	CLIP-seq
MIRT1360575	hsa-miR-764	CLIP-seq
MIRT1360576	hsa-miR-767-5p	CLIP-seq
MIRT1360535	hsa-miR-1246	CLIP-seq
MIRT2106725	hsa-miR-1252	CLIP-seq
MIRT2106726	hsa-miR-1267	CLIP-seq
MIRT2106727	hsa-miR-1268	CLIP-seq
MIRT2106728	hsa-miR-1268b	CLIP-seq
MIRT2106729	hsa-miR-1289	CLIP-seq
MIRT2106730	hsa-miR-1827	CLIP-seq
MIRT2106731	hsa-miR-298	CLIP-seq
MIRT2106732	hsa-miR-3160-5p	CLIP-seq
MIRT2106733	hsa-miR-3176	CLIP-seq
MIRT1360549	hsa-miR-3179	CLIP-seq
MIRT2106734	hsa-miR-3202	CLIP-seq
MIRT1360510	hsa-miR-331-3p	CLIP-seq
MIRT2106735	hsa-miR-339-5p	CLIP-seq
MIRT2106736	hsa-miR-3612	CLIP-seq
MIRT2106737	hsa-miR-3909	CLIP-seq
MIRT2106738	hsa-miR-3922-3p	CLIP-seq
MIRT2106739	hsa-miR-3936	CLIP-seq
MIRT2106740	hsa-miR-3942-3p	CLIP-seq
MIRT2106741	hsa-miR-3942-5p	CLIP-seq
MIRT2106742	hsa-miR-4261	CLIP-seq
MIRT2106743	hsa-miR-4287	CLIP-seq
MIRT1360513	hsa-miR-4292	CLIP-seq
MIRT2106744	hsa-miR-4423-5p	CLIP-seq
MIRT1360516	hsa-miR-4450	CLIP-seq
MIRT2106745	hsa-miR-4469	CLIP-seq
MIRT2106746	hsa-miR-4476	CLIP-seq
MIRT1360519	hsa-miR-4530	CLIP-seq
MIRT2106747	hsa-miR-4652-3p	CLIP-seq
MIRT2106748	hsa-miR-4659a-5p	CLIP-seq
MIRT2106749	hsa-miR-4659b-5p	CLIP-seq
MIRT1360522	hsa-miR-4667-5p	CLIP-seq
MIRT2106750	hsa-miR-4677-3p	CLIP-seq
MIRT2106751	hsa-miR-4685-3p	CLIP-seq
MIRT1360523	hsa-miR-4686	CLIP-seq
MIRT2106752	hsa-miR-4687-3p	CLIP-seq
MIRT2106753	hsa-miR-4687-5p	CLIP-seq
MIRT1360524	hsa-miR-4700-5p	CLIP-seq
MIRT2106754	hsa-miR-4703-5p	CLIP-seq
MIRT2106755	hsa-miR-4757-5p	CLIP-seq
MIRT2106756	hsa-miR-4761-5p	CLIP-seq
MIRT2106757	hsa-miR-4776-3p	CLIP-seq
MIRT1360567	hsa-miR-509-3p	CLIP-seq
MIRT2106758	hsa-miR-5096	CLIP-seq
MIRT2106759	hsa-miR-585	CLIP-seq
MIRT2106760	hsa-miR-626	CLIP-seq
MIRT2106761	hsa-miR-635	CLIP-seq
MIRT2106762	hsa-miR-650	CLIP-seq
MIRT2106763	hsa-miR-759	CLIP-seq
MIRT2330972	hsa-miR-125a-5p	CLIP-seq
MIRT2330973	hsa-miR-125b	CLIP-seq
MIRT1360493	hsa-miR-1273d	CLIP-seq
MIRT1360494	hsa-miR-1294	CLIP-seq
MIRT1360505	hsa-miR-3145-3p	CLIP-seq
MIRT1360507	hsa-miR-3184	CLIP-seq
MIRT1360508	hsa-miR-3192	CLIP-seq
MIRT1360510	hsa-miR-331-3p	CLIP-seq
MIRT1360512	hsa-miR-423-5p	CLIP-seq
MIRT1360513	hsa-miR-4292	CLIP-seq
MIRT1360514	hsa-miR-4314	CLIP-seq
MIRT1360515	hsa-miR-4316	CLIP-seq
MIRT2330974	hsa-miR-4319	CLIP-seq
MIRT1360516	hsa-miR-4450	CLIP-seq
MIRT1360519	hsa-miR-4530	CLIP-seq
MIRT1360520	hsa-miR-4646-5p	CLIP-seq
MIRT2106748	hsa-miR-4659a-5p	CLIP-seq
MIRT2106749	hsa-miR-4659b-5p	CLIP-seq
MIRT1360522	hsa-miR-4667-5p	CLIP-seq
MIRT1360524	hsa-miR-4700-5p	CLIP-seq
MIRT2106756	hsa-miR-4761-5p	CLIP-seq
MIRT2106757	hsa-miR-4776-3p	CLIP-seq
MIRT2106760	hsa-miR-626	CLIP-seq
MIRT2394736	hsa-miR-1972	CLIP-seq
MIRT1360519	hsa-miR-4530	CLIP-seq
MIRT1360530	hsa-miR-1185	CLIP-seq
MIRT1360504	hsa-miR-3123	CLIP-seq
MIRT1360506	hsa-miR-3154	CLIP-seq
MIRT1360551	hsa-miR-3679-5p	CLIP-seq
MIRT1360511	hsa-miR-3925-5p	CLIP-seq
MIRT2625285	hsa-miR-3976	CLIP-seq
MIRT2625286	hsa-miR-548ac	CLIP-seq
MIRT2625287	hsa-miR-548ae	CLIP-seq
MIRT2625288	hsa-miR-548aj	CLIP-seq
MIRT2625289	hsa-miR-548am	CLIP-seq
MIRT2625290	hsa-miR-548d-3p	CLIP-seq
MIRT2625291	hsa-miR-548x	CLIP-seq
MIRT2625292	hsa-miR-548z	CLIP-seq
MIRT1360530	hsa-miR-1185	CLIP-seq
MIRT1360504	hsa-miR-3123	CLIP-seq
MIRT1360506	hsa-miR-3154	CLIP-seq
MIRT1360551	hsa-miR-3679-5p	CLIP-seq
MIRT1360511	hsa-miR-3925-5p	CLIP-seq
MIRT2625285	hsa-miR-3976	CLIP-seq

Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IDA	11326279
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	TAS
GO:0005457	Function	GDP-fucose transmembrane transporter activity	IBA
GO:0005457	Function	GDP-fucose transmembrane transporter activity	IDA	27738779
GO:0005457	Function	GDP-fucose transmembrane transporter activity	IEA
GO:0005457	Function	GDP-fucose transmembrane transporter activity	TAS
GO:0005515	Function	Protein binding	IPI	28514442, 33961781
GO:0005794	Component	Golgi apparatus	IBA
GO:0005794	Component	Golgi apparatus	IDA
GO:0005794	Component	Golgi apparatus	IEA
GO:0015297	Function	Antiporter activity	IBA
GO:0016020	Component	Membrane	IEA
GO:0036085	Process	GDP-fucose import into Golgi lumen	IBA
GO:0036085	Process	GDP-fucose import into Golgi lumen	IDA	11326280
GO:0042350	Process	GDP-L-fucose biosynthetic process	TAS
GO:0042351	Process	'de novo' GDP-L-fucose biosynthetic process	IEA
GO:0042352	Process	GDP-L-fucose salvage	IEA
GO:0045746	Process	Negative regulation of Notch signaling pathway	IEA

MIM	HGNC	e!Ensembl
605881	20197	ENSG00000181830

Q96A29

Protein name

GDP-fucose transporter 1 (Solute carrier family 35 member C1)

Protein function

Antiporter specific for GDP-l-fucose and depending on the concomitant reverse transport of GMP. Involved in GDP-fucose import from the cytoplasm into the Golgi lumen. {ECO:0000269|PubMed:11326279, ECO:0000269|PubMed:11326280, ECO:0000269|PubMed:

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03151	TPT	39 → 338	Triose-phosphate Transporter family	Family

Sequence

MNRAPLKRSRILHMALTGASDPSAEAEANGEKPFLLRALQIALVVSLYWVTSISMVFLNK
YLLDSPSLRLDTPIFVTFYQCLVTTLLCKGLSALAACCPGAVDFPSLRLDLRVARSVLPL
SVVFIGMITFNNLCLKYVGVAFYNVGRSLTTVFNVLLSYLLLKQTTSFYALLTCGIIIGG
FWLGVDQEGAEGTLSWLGTVFGVLASLCVSLNAIYTTKVLPAVDGSIWRLTFYNNVNACI
LFLPLLLLLGELQALRDFAQLGSAHFWGMMTLGGLFGFAIGYVTGLQIKFTSPLTHNVSG
TAKACAQTVLAVLYYEETKSFLWWTSNMMVLGGSSAYTWVRGWEMKKTPEEPSPKDSEKS
AMGV

Sequence length

364

Interactions

View interactions

	Reactome
			Defective SLC35C1 causes congenital disorder of glycosylation 2C (CDG2C) GDP-fucose biosynthesis Transport of nucleotide sugars

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Leukocyte adhesion deficiency type II	Pathogenic; Likely pathogenic	rs398124345, rs2134598310, rs2134598287, rs1470970903, rs28939087, rs28937886, rs766512058, rs2085872592	RCV000133550 RCV001527370 RCV001543359 RCV002048367 RCV000005005 RCV000005006 RCV003611523 RCV001038135 View all (3 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (11)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital disorder of glycosylation	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL DISORDER OF GLYCOSYLATION, TYPE 2C	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL DISORDER OF GLYCOSYLATION, TYPE IIC	—	HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL DISORDERS OF GLYCOSYLATION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DESBUQUOIS SYNDROME	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intellectual disability	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SLC35C1-related disorder	Conflicting classifications of pathogenicity; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (32)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Anxiety	Anxiety Disorder	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Brachydactyly	Brachydactyly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral cortical atrophy	Cerebral cortical atrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	31961998	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital disorder of glycosylation type 2C	Congenital disorder of glycosylation	Pubtator	24403049, 33391282, 35772493	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital disorder of glycosylation, type 2C	Congenital disorder of glycosylation	UNIPROT_DG	11326279, 11326280		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital disorder of glycosylation, type 2C	Congenital disorder of glycosylation	GENOMICS_ENGLAND_DG	11326280, 12476046, 24403049, 27604308		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital disorder of glycosylation, type 2C	Congenital disorder of glycosylation	CLINVAR_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital disorder of glycosylation, type 2C	Congenital disorder of glycosylation	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital disorder of glycosylation, type 2C	Congenital disorder of glycosylation	ORPHANET_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital Disorders of Glycosylation	Congenital disorder of glycosylation	BEFREE	23506892, 29702557, 31095764		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Developmental Disabilities	Developmental disability	Pubtator	24403049	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dubowitz syndrome	Dubowitz syndrome	Pubtator	33098347	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	24403049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Febrile Convulsions	Febrile seizures	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	37005450	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	24403049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	24403049	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukocyte adhesion deficiency type 1	Leukocyte adhesion deficiency	Pubtator	12738772	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukocyte adhesion deficiency type II	Leukocyte adhesion deficiency	Orphanet			★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Liver carcinoma	Liver carcinoma	LHGDN	17884843		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutrophilia (disorder)	Neutrophilia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Obsessive compulsive behavior	Obsessive-Compulsive Disorder	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Recurrent otitis media	Otitis media	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe intellectual disability	Mental retardation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	35945754	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

SLC35C1 (solute carrier family 35 member C1)