Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene Gene ontology Other IDs Protein Associated diseases
Entrez ID	55337
Gene name	Shiftless antiviral inhibitor of ribosomal frameshifting
Gene symbol	SHFL
Synonyms (NCBI Gene)	C19orf66IRAVRyDENSFL
Chromosome	19
Chromosome location	19p13.2

Show/Hide all (29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000932	Component	P-body	IDA	27974568
GO:0000932	Component	P-body	IEA
GO:0003723	Function	RNA binding	IDA	26735137, 27974568
GO:0003723	Function	RNA binding	IEA
GO:0005515	Function	Protein binding	IPI	21044950, 25416956, 25814554, 26735137, 27974568, 30682371, 32296183, 32814053
GO:0005634	Component	Nucleus	IDA	26735137
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	26735137
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0006449	Process	Regulation of translational termination	IDA	30682371
GO:0034340	Process	Response to type I interferon	IDA	26735137
GO:0034341	Process	Response to type II interferon	IDA	26735137
GO:0034342	Process	Response to type III interferon	IDA	26735137
GO:0035456	Process	Response to interferon-beta	IDA	27974568
GO:0042802	Function	Identical protein binding	IPI	32296183
GO:0043022	Function	Ribosome binding	IBA
GO:0043022	Function	Ribosome binding	IDA	30682371
GO:0045071	Process	Negative regulation of viral genome replication	IMP	26735137
GO:0045087	Process	Innate immune response	IBA
GO:0051607	Process	Defense response to virus	IDA	26735137
GO:0051607	Process	Defense response to virus	IEA
GO:0051607	Process	Defense response to virus	IMP	27974568
GO:0075523	Process	Viral translational frameshifting	IBA
GO:0075523	Process	Viral translational frameshifting	IDA	30682371
GO:1990825	Function	Sequence-specific mRNA binding	IBA
GO:1990825	Function	Sequence-specific mRNA binding	IDA	30682371
GO:2001125	Process	Negative regulation of translational frameshifting	IDA	30682371

MIM	HGNC	e!Ensembl
616808	25649	ENSG00000130813

Q9NUL5

Protein name

Shiftless antiviral inhibitor of ribosomal frameshifting protein (SFL) (SHFL) (Interferon-regulated antiviral protein) (IRAV) (Repressor of yield of DENV protein) (RyDEN)

Protein function

Inhibits programmed -1 ribosomal frameshifting (-1PRF) of a variety of mRNAs from viruses, such as HIV1, and cellular genes, such as PEG10. Interacts with the -1PRF signal of target mRNA and translating ribosomes and causes premature translation

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15135	UPF0515	16 → 272	Uncharacterised protein UPF0515	Family

Sequence

MSQEGVELEKSVRRLREKFHGKVSSKKAGALMRKFGSDHTGVGRSIVYGVKQKDGQELSN
DLDAQDPPEDMKQDRDIQAVATSLLPLTEANLRMFQRAQDDLIPAVDRQFACSSCDHVWW
RRVPQRKEVSRCRKCRKRYEPVPADKMWGLAEFHCPKCRHNFRGWAQMGSPSPCYGCGFP
VYPTRILPPRWDRDPDRRSTHTHSCSAADCYNRREPHVPGTSCAHPKSRKQNHLPKVLHP
SNPHISSGSTVATCLSQGGLLEDLDNLILEDLKEEEEEEEEVEDEEGGPRE

Sequence length

291

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
HEREDITARY SENSORY AND AUTONOMIC NEUROPATHY TYPE IE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (5)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32294532	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	32294532	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	32294532	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	30944177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	30944177	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

SHFL (shiftless antiviral inhibitor of ribosomal frameshifting)