Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5533
Gene name	Protein phosphatase 3 catalytic subunit gamma
Gene symbol	PPP3CC
Synonyms (NCBI Gene)	CALNA3CNA3PP2Bgamma
Chromosome	8
Chromosome location	8p21.3
Summary	Calcineurin is a calcium-dependent, calmodulin-stimulated protein phosphatase involved in the downstream regulation of dopaminergic signal transduction. Calcineurin is composed of a regulatory subunit and a catalytic subunit. The protein encoded by this g

Show/Hide all (31)

miRTarBase ID	miRNA	Experiments	Reference
MIRT714710	hsa-miR-3922-5p	HITS-CLIP	19536157
MIRT714709	hsa-miR-6832-3p	HITS-CLIP	19536157
MIRT714708	hsa-miR-655-5p	HITS-CLIP	19536157
MIRT714707	hsa-miR-377-5p	HITS-CLIP	19536157
MIRT714705	hsa-miR-6086	HITS-CLIP	19536157
MIRT714706	hsa-miR-6851-3p	HITS-CLIP	19536157
MIRT714710	hsa-miR-3922-5p	HITS-CLIP	19536157
MIRT714709	hsa-miR-6832-3p	HITS-CLIP	19536157
MIRT714708	hsa-miR-655-5p	HITS-CLIP	19536157
MIRT714707	hsa-miR-377-5p	HITS-CLIP	19536157
MIRT714705	hsa-miR-6086	HITS-CLIP	19536157
MIRT714706	hsa-miR-6851-3p	HITS-CLIP	19536157
MIRT1258258	hsa-miR-2052	CLIP-seq
MIRT1258259	hsa-miR-340	CLIP-seq
MIRT1258260	hsa-miR-3616-5p	CLIP-seq
MIRT1258261	hsa-miR-3647-5p	CLIP-seq
MIRT1258262	hsa-miR-382	CLIP-seq
MIRT1258263	hsa-miR-4670-3p	CLIP-seq
MIRT1258264	hsa-miR-501-3p	CLIP-seq
MIRT1258265	hsa-miR-502-3p	CLIP-seq
MIRT1258266	hsa-miR-573	CLIP-seq
MIRT2599446	hsa-miR-3148	CLIP-seq
MIRT2599447	hsa-miR-4282	CLIP-seq
MIRT2599448	hsa-miR-4434	CLIP-seq
MIRT2599449	hsa-miR-4516	CLIP-seq
MIRT2599450	hsa-miR-4531	CLIP-seq
MIRT2599451	hsa-miR-4668-5p	CLIP-seq
MIRT2599452	hsa-miR-4802-5p	CLIP-seq
MIRT2599453	hsa-miR-549	CLIP-seq
MIRT2599454	hsa-miR-579	CLIP-seq
MIRT2599455	hsa-miR-664	CLIP-seq

Show/Hide all (31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004721	Function	Phosphoprotein phosphatase activity	IEA
GO:0004722	Function	Protein serine/threonine phosphatase activity	IEA
GO:0004723	Function	Calcium-dependent protein serine/threonine phosphatase activity	IDA	26429887
GO:0005515	Function	Protein binding	IPI	25416956, 28514442, 32296183, 32814053, 33961781, 34446558
GO:0005516	Function	Calmodulin binding	IBA
GO:0005516	Function	Calmodulin binding	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	19154138
GO:0005739	Component	Mitochondrion	IEA
GO:0005829	Component	Cytosol	NAS	22343722, 28126489
GO:0005829	Component	Cytosol	TAS
GO:0005955	Component	Calcineurin complex	IBA
GO:0005955	Component	Calcineurin complex	NAS	11123943
GO:0006470	Process	Protein dephosphorylation	IDA	19154138
GO:0008287	Component	Protein serine/threonine phosphatase complex	NAS	22343722
GO:0016787	Function	Hydrolase activity	IEA
GO:0033173	Process	Calcineurin-NFAT signaling cascade	IDA	19154138
GO:0033173	Process	Calcineurin-NFAT signaling cascade	IEA
GO:0033192	Function	Calmodulin-dependent protein phosphatase activity	IBA
GO:0033192	Function	Calmodulin-dependent protein phosphatase activity	IDA	19154138
GO:0033192	Function	Calmodulin-dependent protein phosphatase activity	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0070886	Process	Positive regulation of calcineurin-NFAT signaling cascade	NAS	8631904, 22343722
GO:0097720	Process	Calcineurin-mediated signaling	IBA
GO:0097720	Process	Calcineurin-mediated signaling	IEA
GO:0098793	Component	Presynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:1900242	Process	Regulation of synaptic vesicle endocytosis	IEA
GO:1900244	Process	Positive regulation of synaptic vesicle endocytosis	IEA
GO:1905665	Process	Positive regulation of calcium ion import across plasma membrane	NAS	17640527
GO:1905949	Process	Negative regulation of calcium ion import across plasma membrane	NAS	17640527

MIM	HGNC	e!Ensembl
114107	9316	ENSG00000120910

P48454

Protein name

Serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calcineurin, testis-specific catalytic subunit) (Calmodulin-dependent calcineurin A subunit gamma isoform)

Protein function

Calcium-dependent, calmodulin-stimulated protein phosphatase which plays an essential role in the transduction of intracellular Ca(2+)-mediated signals. Dephosphorylates and activates transcription factor NFATC1. Dephosphorylates and inactivates

PDB

7U0T

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00149	Metallophos	79 → 281	Calcineurin-like phosphoesterase	Domain

Tissue specificity

TISSUE SPECIFICITY: Testis. {ECO:0000269|PubMed:1339277}.

Sequence

MSGRRFHLSTTDRVIKAVPFPPTQRLTFKEVFENGKPKVDVLKNHLVKEGRLEEEVALKI
INDGAAILRQEKTMIEVDAPITVCGDIHGQFFDLMKLFEVGGSPSNTRYLFLGDYVDRGY
FSIECVLYLWSLKINHPKTLFLLRGNHECRHLTDYFTFKQECRIKYSEQVYDACMETFDC
LPLAALLNQQFLCVHGGMSPEITSLDDIRKLDRFTEPPAFGPVCDLLWSDPSEDYGNEKT
LEHYTHNTVRGCSYFYSYPAVCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQATGFPSLIT
IFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEM
LVNVLNICSDDELISDDEAEGSTTVRKEIIRNKIRAIGKMARVFSILRQESESVLTLKGL
TPTGTLPLGVLSGGKQTIETATVEAVEAREAIRGFSLQHKIRSFEEARGLDRINERMPPR
KDSIHAGGPMKSVTSAHSHAAHRSDQGKKAHS

Sequence length

512

Interactions

View interactions

	KEGG		Reactome
	MAPK signaling pathway Calcium signaling pathway cGMP-PKG signaling pathway Oocyte meiosis Cellular senescence Wnt signaling pathway Axon guidance VEGF signaling pathway Osteoclast differentiation C-type lectin receptor signaling pathway Natural killer cell mediated cytotoxicity Th1 and Th2 cell differentiation Th17 cell differentiation T cell receptor signaling pathway B cell receptor signaling pathway Long-term potentiation Glutamatergic synapse Dopaminergic synapse Oxytocin signaling pathway Glucagon signaling pathway Renin secretion Alzheimer disease Amyotrophic lateral sclerosis Prion disease Pathways of neurodegeneration - multiple diseases Amphetamine addiction Tuberculosis Human cytomegalovirus infection Human T-cell leukemia virus 1 infection Kaposi sarcoma-associated herpesvirus infection Human immunodeficiency virus 1 infection PD-L1 expression and PD-1 checkpoint pathway in cancer Lipid and atherosclerosis		Activation of BAD and translocation to mitochondria

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BIPOLAR DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GENETIC PREDISPOSITION TO DISEASE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Keratoconus	Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
MENTAL DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONORGANIC PSYCHOSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHOTIC DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (24)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Asthenozoospermia	Asthenozoospermia	BEFREE	26429887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	19204725		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	BEFREE	29275364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	CTD_human_DG	29275364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Injuries	Brain injuries	Pubtator	27225880	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	29275364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	34573382	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	PSYGENET_DG	19204725		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertension	Hypertension	Pubtator	29237677	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	29275364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	CTD_human_DG	29275364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	PSYGENET_DG	19204725		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonorganic psychosis	Nonorganic Psychosis	PSYGENET_DG	18343007		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	37399741	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	33270085	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	18460741		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	18460741	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	PSYGENET_DG	18343007		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	12851458, 15820226, 15843870, 17185513, 17339875, 18991849, 20537399, 23497497, 27106592, 29260453		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	12851458, 15820226, 17339875, 17895921, 18343007		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	17339875, 18343007, 23497497, 24399042		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	27106592	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	29275364	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	29275364	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

PPP3CC (protein phosphatase 3 catalytic subunit gamma)