RNLS (renalase, FAD dependent amine oxidase)

Gene

• Entrez ID: 55328
• Gene name: Renalase, FAD dependent amine oxidase
• Gene symbol: RNLS
• Synonyms (NCBI Gene): C10orf59, RENALASE
• Chromosome: 10
• Chromosome location: 10q23.31
• Summary: Renalase is a flavin adenine dinucleotide-dependent amine oxidase that is secreted into the blood from the kidney (Xu et al., 2005 [PubMed 15841207]).[supplied by OMIM, Mar 2008]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT458083	hsa-miR-548n	PAR-CLIP	23592263
MIRT458082	hsa-miR-18a-5p	PAR-CLIP	23592263
MIRT458081	hsa-miR-18b-5p	PAR-CLIP	23592263
MIRT458080	hsa-miR-4735-3p	PAR-CLIP	23592263
MIRT458079	hsa-miR-5584-5p	PAR-CLIP	23592263
MIRT458078	hsa-miR-6750-5p	PAR-CLIP	23592263
MIRT458077	hsa-miR-6822-5p	PAR-CLIP	23592263
MIRT458076	hsa-miR-9500	PAR-CLIP	23592263
MIRT458075	hsa-miR-892c-5p	PAR-CLIP	23592263
MIRT458074	hsa-miR-4708-3p	PAR-CLIP	23592263
MIRT458073	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT458071	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT458083	hsa-miR-548n	PAR-CLIP	23592263
MIRT458082	hsa-miR-18a-5p	PAR-CLIP	23592263
MIRT458081	hsa-miR-18b-5p	PAR-CLIP	23592263
MIRT458080	hsa-miR-4735-3p	PAR-CLIP	23592263
MIRT458079	hsa-miR-5584-5p	PAR-CLIP	23592263
MIRT458078	hsa-miR-6750-5p	PAR-CLIP	23592263
MIRT458077	hsa-miR-6822-5p	PAR-CLIP	23592263
MIRT458076	hsa-miR-9500	PAR-CLIP	23592263
MIRT458075	hsa-miR-892c-5p	PAR-CLIP	23592263
MIRT458074	hsa-miR-4708-3p	PAR-CLIP	23592263
MIRT458073	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT458071	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT1314025	hsa-miR-1273d	CLIP-seq
MIRT1314026	hsa-miR-142-5p	CLIP-seq
MIRT1314027	hsa-miR-194	CLIP-seq
MIRT1314028	hsa-miR-3120-3p	CLIP-seq
MIRT1314029	hsa-miR-4434	CLIP-seq
MIRT1314030	hsa-miR-4516	CLIP-seq
MIRT1314031	hsa-miR-4531	CLIP-seq
MIRT1314032	hsa-miR-548a-5p	CLIP-seq
MIRT1314033	hsa-miR-548ab	CLIP-seq
MIRT1314034	hsa-miR-548ak	CLIP-seq
MIRT1314035	hsa-miR-548b-5p	CLIP-seq
MIRT1314036	hsa-miR-548c-5p	CLIP-seq
MIRT1314037	hsa-miR-548d-5p	CLIP-seq
MIRT1314038	hsa-miR-548h	CLIP-seq
MIRT1314039	hsa-miR-548i	CLIP-seq
MIRT1314040	hsa-miR-548j	CLIP-seq
MIRT1314041	hsa-miR-548k	CLIP-seq
MIRT1314042	hsa-miR-548l	CLIP-seq
MIRT1314043	hsa-miR-548w	CLIP-seq
MIRT1314044	hsa-miR-548y	CLIP-seq
MIRT1314045	hsa-miR-559	CLIP-seq
MIRT1314046	hsa-miR-589	CLIP-seq
MIRT1314047	hsa-miR-802	CLIP-seq
MIRT1314048	hsa-miR-103a	CLIP-seq
MIRT1314049	hsa-miR-107	CLIP-seq
MIRT1314050	hsa-miR-1224-3p	CLIP-seq
MIRT1314051	hsa-miR-1260	CLIP-seq
MIRT1314052	hsa-miR-1260b	CLIP-seq
MIRT1314053	hsa-miR-1279	CLIP-seq
MIRT1314054	hsa-miR-1280	CLIP-seq
MIRT1314055	hsa-miR-1301	CLIP-seq
MIRT1314056	hsa-miR-181a	CLIP-seq
MIRT1314057	hsa-miR-181b	CLIP-seq
MIRT1314058	hsa-miR-181c	CLIP-seq
MIRT1314059	hsa-miR-181d	CLIP-seq
MIRT1314060	hsa-miR-1827	CLIP-seq
MIRT1314061	hsa-miR-188-3p	CLIP-seq
MIRT1314062	hsa-miR-204	CLIP-seq
MIRT1314063	hsa-miR-211	CLIP-seq
MIRT1314064	hsa-miR-221	CLIP-seq
MIRT1314065	hsa-miR-222	CLIP-seq
MIRT1314066	hsa-miR-25	CLIP-seq
MIRT1314067	hsa-miR-3156-3p	CLIP-seq
MIRT1314068	hsa-miR-32	CLIP-seq
MIRT1314069	hsa-miR-363	CLIP-seq
MIRT1314070	hsa-miR-3667-3p	CLIP-seq
MIRT1314071	hsa-miR-367	CLIP-seq
MIRT1314072	hsa-miR-4262	CLIP-seq
MIRT1314073	hsa-miR-4477b	CLIP-seq
MIRT1314074	hsa-miR-4755-5p	CLIP-seq
MIRT1314075	hsa-miR-4789-3p	CLIP-seq
MIRT1314076	hsa-miR-499-3p	CLIP-seq
MIRT1314077	hsa-miR-499a-3p	CLIP-seq
MIRT1314078	hsa-miR-5047	CLIP-seq
MIRT1314079	hsa-miR-623	CLIP-seq
MIRT1314080	hsa-miR-92a	CLIP-seq
MIRT1314081	hsa-miR-92b	CLIP-seq
MIRT2093409	hsa-miR-103b	CLIP-seq
MIRT2093410	hsa-miR-1238	CLIP-seq
MIRT2093411	hsa-miR-4691-5p	CLIP-seq
MIRT2093412	hsa-miR-4775	CLIP-seq
MIRT2093413	hsa-miR-3180-5p	CLIP-seq
MIRT2093414	hsa-miR-665	CLIP-seq
MIRT2093415	hsa-miR-892a	CLIP-seq
MIRT2093416	hsa-miR-943	CLIP-seq
MIRT2093413	hsa-miR-3180-5p	CLIP-seq
MIRT2093414	hsa-miR-665	CLIP-seq
MIRT2093415	hsa-miR-892a	CLIP-seq
MIRT2093416	hsa-miR-943	CLIP-seq
MIRT2458491	hsa-miR-129-5p	CLIP-seq
MIRT2458492	hsa-miR-3152-3p	CLIP-seq
MIRT2458493	hsa-miR-513a-3p	CLIP-seq
MIRT2613708	hsa-miR-140-3p	CLIP-seq
MIRT2613709	hsa-miR-3120-5p	CLIP-seq
MIRT2613710	hsa-miR-3144-3p	CLIP-seq
MIRT2613711	hsa-miR-4652-3p	CLIP-seq
MIRT2613709	hsa-miR-3120-5p	CLIP-seq
MIRT2613711	hsa-miR-4652-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002931	Process	Response to ischemia	IEA
GO:0005515	Function	Protein binding	IPI	25906147
GO:0005576	Component	Extracellular region	IBA
GO:0005576	Component	Extracellular region	IDA	15841207
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IEA
GO:0010459	Process	Negative regulation of heart rate	IDA	15841207
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016651	Function	Oxidoreductase activity, acting on NAD(P)H	IBA
GO:0016651	Function	Oxidoreductase activity, acting on NAD(P)H	IDA	23964689, 25531177
GO:0016651	Function	Oxidoreductase activity, acting on NAD(P)H	IEA
GO:0045776	Process	Negative regulation of blood pressure	IDA	15841207
GO:0051379	Function	Epinephrine binding	IDA	23964689
GO:0070404	Function	NADH binding	IDA	25531177
GO:0071869	Process	Response to catecholamine	IEA
GO:0071871	Process	Response to epinephrine	IEA
GO:0097621	Function	Monoamine oxidase activity	IMP	15841207
GO:1902074	Process	Response to salt	IEA

Other IDs

• MIM: 609360
• HGNC: 25641
• e!Ensembl: ENSG00000184719

Protein

• UniProt ID: Q5VYX0
• Protein name: Renalase (EC 1.6.3.5) (Monoamine oxidase-C) (MAO-C)
• Protein function: Catalyzes the oxidation of the less abundant 1,2-dihydro-beta-NAD(P) and 1,6-dihydro-beta-NAD(P) to form beta-NAD(P)(+). The enzyme hormone is secreted by the kidney, and circulates in blood and modulates cardiac function and systemic blood pres
• PDB: 3QJ4
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13450	NAD_binding_8	6 → 80		Domain
  PF01593	Amino_oxidase	84 → 332	Flavin containing amine oxidoreductase	Domain

• Tissue specificity: TISSUE SPECIFICITY: Secreted into the blood by the kidney. Highly expressed in the kidney, expressed at lower level in heart, skeletal muscle and small intestine. Its plasma concentration is markedly reduced in patients with end-stage renal disease, as co
• Sequence:

  MAQVLIVGAGMTGSLCAALLRRQTSGPLYLAVWDKAEDSGGRMTTACSPHNPQCTADLGA
  QYITCTPHYAKKHQRFYDELLAYGVLRPLSSPIEGMVMKEGDCNFVAPQGISSIIKHYLK
  ESGAEVYFRHRVTQINLRDDKWEVSKQTGSPEQFDLIVLTMPVPEILQLQGDITTLISEC
  QRQQLEAVSYSSRYALGLFYEAGTKIDVPWAGQYITSNPCIRFVSIDNKKRNIESSEIGP
  SLVIHTTVPFGVTYLEHSIEDVQELVFQQLENILPGLPQPIATKCQKWRHSQVTNAAANC
  PGQMTLHHKPFLACGGDGFTQSNFDGCITSALCVLEALKNYI

• Sequence length: 342

Pathways

Reactome:

Nicotinamide salvaging

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CATARACT	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASE STAGE 5	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESSENTIAL HYPERTENSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Family history	association	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPEROPIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROLITHIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER, FAMILIAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stage 5 chronic kidney disease	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	GWASCAT_DG	29924316		★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic Valve Sclerosis	BEFREE	29065134		★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic valve stenosis	Pubtator	29065134	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	GWASCAT_DG	26297903		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	34587190	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomegaly	Cardiomegaly	Pubtator	20975995, 29065134, 34156537	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	29065134	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	27023477, 28372594	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	30181378, 34603559	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	21964580		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	21617193		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Kidney Diseases	Kidney Disease	BEFREE	25484193		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	24821235, 27023477, 30181378		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	20975995, 27023477, 30181378	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	24821235, 27023477, 30181378		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Disease	Coronary artery disease	Pubtator	24821235	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	24821235, 27023477, 30181378		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	21964580, 25906147, 29172403	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	21270831, 22403184, 22891215, 26053495	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	21964580, 26053495, 34156537	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	22891215, 24992568		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	25751624		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	21964580, 26053495		★☆☆☆☆ Found in Text Mining only
Diabetic Ketoacidosis	Diabetic Ketoacidosis	BEFREE	23755131		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	34156537	Associate	★☆☆☆☆ Found in Text Mining only
Duane Retraction Syndrome	Duane retraction syndrome	Pubtator	34156537	Associate	★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	17216203		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Essential Hypertension	Hypertension	Pubtator	25906147, 30181378	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Diseases	Heart disease	Pubtator	20975995, 25906147	Associate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	28372594	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	21964580, 22812913, 24821235, 25171187, 25531090, 25906147, 34156537, 36789764	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	LHGDN	17216203, 17565281		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	21617193, 21964580, 22227817, 22812913, 24821235, 27434211		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertrophy Left Ventricular	Left ventricular disease	Pubtator	20975995, 29065134	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	29065134	Associate	★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron overload	Pubtator	29065134	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	23564542, 24014100, 30181378		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	LHGDN	17565281		★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	27023477, 27577995, 30181378	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	21617193		★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	29065134		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	26431044	Stimulate	★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial ischemia	Pubtator	25906147	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	26972355		★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	22403184	Associate	★☆☆☆☆ Found in Text Mining only
Prostate cancer, familial	Prostate cancer	CTD_human_DG	29892016		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER, HEREDITARY, 1	Prostate Cancer, Hereditary	CTD_human_DG	29892016		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	GWASCAT_DG	29892016		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sick Sinus Syndrome	Sick sinus syndrome	Pubtator	34587190	Stimulate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	21964580, 25906147, 34156537	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Dysfunction	Ventricular dysfunction	Pubtator	20975995	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Dysfunction Left	Ventricular dysfunction	Pubtator	20975995	Associate	★☆☆☆☆ Found in Text Mining only