Gene Gene information from NCBI Gene database.
Entrez ID 5532
Gene name Protein phosphatase 3 catalytic subunit beta
Gene symbol PPP3CB
Synonyms (NCBI Gene)
CALNA2CALNBCNA2PP2Bbeta
Chromosome 10
Chromosome location 10q22.2
miRNA miRNA information provided by mirtarbase database.
202
miRTarBase ID miRNA Experiments Reference
MIRT047460 hsa-miR-10b-5p CLASH 23622248
MIRT572809 hsa-miR-6769a-3p PAR-CLIP 20371350
MIRT572810 hsa-miR-181a-2-3p PAR-CLIP 20371350
MIRT572808 hsa-miR-1273g-3p PAR-CLIP 20371350
MIRT572807 hsa-miR-875-3p PAR-CLIP 20371350
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
83
GO ID Ontology Definition Evidence Reference
GO:0001913 Process T cell mediated cytotoxicity IEA
GO:0001915 Process Negative regulation of T cell mediated cytotoxicity IEA
GO:0001946 Process Lymphangiogenesis IEA
GO:0004721 Function Phosphoprotein phosphatase activity IEA
GO:0004722 Function Protein serine/threonine phosphatase activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
114106 9315 ENSG00000107758
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P16298
Protein name Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calmodulin-dependent calcineurin A subunit beta isoform) (CNA beta)
Protein function Calcium-dependent, calmodulin-stimulated protein phosphatase which plays an essential role in the transduction of intracellular Ca(2+)-mediated signals (PubMed:19154138, PubMed:25720963, PubMed:26794871, PubMed:32753672). Dephosphorylates TFEB i
PDB 4OR9 , 4ORA , 4ORC
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00149 Metallophos 92 294 Calcineurin-like phosphoesterase Domain
Sequence
MAAPEPARAAPPPPPPPPPPPGADRVVKAVPFPPTHRLTSEEVFDLDGIPRVDVLKNHLV
KEGRVDEEIALRIINEGAAILRREKTMIEVEAPITVCGDIHGQFFDLMKLFEVGGSPANT
RYLFLGDYVDRGYFSIECVLYLWVLKILYPSTLFLLRGNHECRHLTEYFTFKQECKIKYS
ERVYEACMEAFDSLPLAALLNQQFLCVHGGLSPEIHTLDDIRRLDRFKEPPAFGPMCDLL
WSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLSIIRAHEAQD
AGYRMY
RKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFT
WSLPFVGEKVTEMLVNVLSICSDDELMTEGEDQFDGSAAARKEIIRNKIRAIGKMARVFS
VLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRICSFE
EAKGLDRINERMPPRKDAVQQDGFNSLNTAHATENHGTGNHTAQ
Sequence length 524
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  MAPK signaling pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Oocyte meiosis
Cellular senescence
Wnt signaling pathway
Axon guidance
VEGF signaling pathway
Osteoclast differentiation
C-type lectin receptor signaling pathway
Natural killer cell mediated cytotoxicity
Th1 and Th2 cell differentiation
Th17 cell differentiation
T cell receptor signaling pathway
B cell receptor signaling pathway
Long-term potentiation
Glutamatergic synapse
Dopaminergic synapse
Oxytocin signaling pathway
Glucagon signaling pathway
Renin secretion
Alzheimer disease
Amyotrophic lateral sclerosis
Prion disease
Pathways of neurodegeneration - multiple diseases
Amphetamine addiction
Tuberculosis
Human cytomegalovirus infection
Human T-cell leukemia virus 1 infection
Kaposi sarcoma-associated herpesvirus infection
Human immunodeficiency virus 1 infection
PD-L1 expression and PD-1 checkpoint pathway in cancer
Lipid and atherosclerosis
  Calcineurin activates NFAT
FCERI mediated Ca+2 mobilization
Ca2+ pathway
CLEC7A (Dectin-1) induces NFAT activation
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
CONGENITAL STENOSIS OF AORTIC VALVE Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
HEPATOLENTICULAR DEGENERATION CTD, Disgenet
CTD, Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Aortic Valve Stenosis Aortic Valve Sclerosis BEFREE 15533858
★☆☆☆☆
Found in Text Mining only
Bipolar Disorder Bipolar Disorder BEFREE 26899345
★☆☆☆☆
Found in Text Mining only
Cornea plana Cornea Plana BEFREE 7601455, 8723718, 8825624, 8929947
★☆☆☆☆
Found in Text Mining only
Cornea Plana 1 Cornea plana Pubtator 8723718, 8929947 Associate
★☆☆☆☆
Found in Text Mining only
Hepatic Form of Wilson Disease Hepatolenticular degeneration CTD_human_DG 23519153
★☆☆☆☆
Found in Text Mining only
Hepatolenticular Degeneration Hepatolenticular Degeneration CTD_human_DG 23519153
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Hyperglycemia Hyperglycemia Pubtator 23985558 Inhibit
★☆☆☆☆
Found in Text Mining only
Neoplasms Neoplasms BEFREE 30457174, 30641937
★☆☆☆☆
Found in Text Mining only
Neuroblastoma Neuroblastoma BEFREE 30457174
★☆☆☆☆
Found in Text Mining only
Pancreatic Neoplasms Pancreatic neoplasm Pubtator 22078386 Associate
★☆☆☆☆
Found in Text Mining only