Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	55303
Gene name	GTPase, IMAP family member 4
Gene symbol	GIMAP4
Synonyms (NCBI Gene)	IAN-1IAN1IMAP4MSTP062
Chromosome	7
Chromosome location	7q36.1
Summary	This gene encodes a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. The encoded protein of this gene may be negatively regulated by T-cell acute lymphocytic leukemia

Show/Hide all (75)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021274	hsa-miR-146a-5p	Microarray	18057241
MIRT023838	hsa-miR-1-3p	Microarray	18668037
MIRT545571	hsa-miR-4282	PAR-CLIP	21572407
MIRT545570	hsa-miR-548a-5p	PAR-CLIP	21572407
MIRT545569	hsa-miR-548ab	PAR-CLIP	21572407
MIRT545568	hsa-miR-548ad-5p	PAR-CLIP	21572407
MIRT545567	hsa-miR-548ae-5p	PAR-CLIP	21572407
MIRT545566	hsa-miR-548ak	PAR-CLIP	21572407
MIRT545565	hsa-miR-548am-5p	PAR-CLIP	21572407
MIRT545564	hsa-miR-548ap-5p	PAR-CLIP	21572407
MIRT545563	hsa-miR-548aq-5p	PAR-CLIP	21572407
MIRT545562	hsa-miR-548ar-5p	PAR-CLIP	21572407
MIRT545561	hsa-miR-548as-5p	PAR-CLIP	21572407
MIRT545560	hsa-miR-548au-5p	PAR-CLIP	21572407
MIRT545559	hsa-miR-548ay-5p	PAR-CLIP	21572407
MIRT545558	hsa-miR-548b-5p	PAR-CLIP	21572407
MIRT545557	hsa-miR-548bb-5p	PAR-CLIP	21572407
MIRT545556	hsa-miR-548c-5p	PAR-CLIP	21572407
MIRT545555	hsa-miR-548d-5p	PAR-CLIP	21572407
MIRT545554	hsa-miR-548h-5p	PAR-CLIP	21572407
MIRT545553	hsa-miR-548i	PAR-CLIP	21572407
MIRT545552	hsa-miR-548j-5p	PAR-CLIP	21572407
MIRT545551	hsa-miR-548o-5p	PAR-CLIP	21572407
MIRT545550	hsa-miR-548w	PAR-CLIP	21572407
MIRT545549	hsa-miR-548y	PAR-CLIP	21572407
MIRT545548	hsa-miR-559	PAR-CLIP	21572407
MIRT545547	hsa-miR-548av-5p	PAR-CLIP	21572407
MIRT545546	hsa-miR-548k	PAR-CLIP	21572407
MIRT545544	hsa-miR-8054	PAR-CLIP	21572407
MIRT545545	hsa-miR-548l	PAR-CLIP	21572407
MIRT545543	hsa-miR-3163	PAR-CLIP	21572407
MIRT545542	hsa-miR-369-3p	PAR-CLIP	21572407
MIRT545541	hsa-miR-5692b	PAR-CLIP	21572407
MIRT545540	hsa-miR-5692c	PAR-CLIP	21572407
MIRT545539	hsa-miR-374a-5p	PAR-CLIP	21572407
MIRT545538	hsa-miR-374b-5p	PAR-CLIP	21572407
MIRT545571	hsa-miR-4282	PAR-CLIP	21572407
MIRT545570	hsa-miR-548a-5p	PAR-CLIP	21572407
MIRT545569	hsa-miR-548ab	PAR-CLIP	21572407
MIRT545568	hsa-miR-548ad-5p	PAR-CLIP	21572407
MIRT545567	hsa-miR-548ae-5p	PAR-CLIP	21572407
MIRT545566	hsa-miR-548ak	PAR-CLIP	21572407
MIRT545565	hsa-miR-548am-5p	PAR-CLIP	21572407
MIRT545564	hsa-miR-548ap-5p	PAR-CLIP	21572407
MIRT545563	hsa-miR-548aq-5p	PAR-CLIP	21572407
MIRT545562	hsa-miR-548ar-5p	PAR-CLIP	21572407
MIRT545561	hsa-miR-548as-5p	PAR-CLIP	21572407
MIRT545560	hsa-miR-548au-5p	PAR-CLIP	21572407
MIRT545559	hsa-miR-548ay-5p	PAR-CLIP	21572407
MIRT545558	hsa-miR-548b-5p	PAR-CLIP	21572407
MIRT545557	hsa-miR-548bb-5p	PAR-CLIP	21572407
MIRT545556	hsa-miR-548c-5p	PAR-CLIP	21572407
MIRT545555	hsa-miR-548d-5p	PAR-CLIP	21572407
MIRT545554	hsa-miR-548h-5p	PAR-CLIP	21572407
MIRT545553	hsa-miR-548i	PAR-CLIP	21572407
MIRT545552	hsa-miR-548j-5p	PAR-CLIP	21572407
MIRT545551	hsa-miR-548o-5p	PAR-CLIP	21572407
MIRT545550	hsa-miR-548w	PAR-CLIP	21572407
MIRT545549	hsa-miR-548y	PAR-CLIP	21572407
MIRT545548	hsa-miR-559	PAR-CLIP	21572407
MIRT545547	hsa-miR-548av-5p	PAR-CLIP	21572407
MIRT545546	hsa-miR-548k	PAR-CLIP	21572407
MIRT545544	hsa-miR-8054	PAR-CLIP	21572407
MIRT545545	hsa-miR-548l	PAR-CLIP	21572407
MIRT545543	hsa-miR-3163	PAR-CLIP	21572407
MIRT545542	hsa-miR-369-3p	PAR-CLIP	21572407
MIRT545541	hsa-miR-5692b	PAR-CLIP	21572407
MIRT545540	hsa-miR-5692c	PAR-CLIP	21572407
MIRT545539	hsa-miR-374a-5p	PAR-CLIP	21572407
MIRT545538	hsa-miR-374b-5p	PAR-CLIP	21572407
MIRT1018963	hsa-miR-186	CLIP-seq
MIRT1018964	hsa-miR-217	CLIP-seq
MIRT1018965	hsa-miR-4418	CLIP-seq
MIRT1018966	hsa-miR-509-3-5p	CLIP-seq
MIRT1018967	hsa-miR-509-5p	CLIP-seq

Show/Hide all (7)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003924	Function	GTPase activity	IBA
GO:0005525	Function	GTP binding	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	23454188
GO:0005829	Component	Cytosol	IEA

MIM	HGNC	e!Ensembl
608087	21872	ENSG00000133574

Q9NUV9

Protein name

GTPase IMAP family member 4 (Immunity-associated nucleotide 1 protein) (IAN-1) (hIAN1) (Immunity-associated protein 4)

Protein function

During thymocyte development, may play a role in the regulation of apoptosis (By similarity). GTPase which exhibits a higher affinity for GDP than for GTP.

PDB

3LXX

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04548	AIG1	31 → 241	AIG1 family	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in spleen and peripheral blood leukocytes that contain mostly T- and B-lymphocytes. Expressed specifically in resting T- and B-lymphocytes and expression significantly decreases during B- or T-lymphocyte activation. Ex

Sequence

MAAQYGSMSFNPSTPGASYGPGRQEPRNSQLRIVLVGKTGAGKSATGNSILGRKVFHSGT
AAKSITKKCEKRSSSWKETELVVVDTPGIFDTEVPNAETSKEIIRCILLTSPGPHALLLV
VPLGRYTEEEHKATEKILKMFGERARSFMILIFTRKDDLGDTNLHDYLREAPEDIQDLMD
IFGDRYCALNNKATGAEQEAQRAQLLGLIQRVVRENKEGCYTNRMYQRAEEEIQKQTQAM
QELHRVELEREKARIREEYEEKIRKLEDKVEQEKRKKQMEKKLAEQEAHYAVRQQRARTE
VESKDGILELIMTALQIASFILLRLFAED

Sequence length

329

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (10)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Allergic sensitization	Allergic Sensitization	BEFREE	25964488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	25964488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	32523132	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	36304068	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	25964488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	32523132	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemoglobinuria Paroxysmal	Hemoglobinuria paroxysmal	Pubtator	28630090	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	25964488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	32045668, 36246963	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	35782114	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

GIMAP4 (GTPase, IMAP family member 4)