AVPR1B (arginine vasopressin receptor 1B)

Gene

• Entrez ID: 553
• Gene name: Arginine vasopressin receptor 1B
• Gene symbol: AVPR1B
• Synonyms (NCBI Gene): AVPR3, V1bR, VPR3
• Chromosome: 1
• Chromosome location: 1q32.1
• Summary: The protein encoded by this gene acts as receptor for arginine vasopressin. This receptor belongs to the subfamily of G-protein coupled receptors which includes AVPR1A, V2R and OXT receptors. Its activity is mediated by G proteins which stimulate a phosph

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019153	hsa-miR-335-5p	Microarray	18185580
MIRT2179159	hsa-miR-199a-5p	CLIP-seq
MIRT2179160	hsa-miR-199b-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001992	Process	Regulation of systemic arterial blood pressure by vasopressin	IBA
GO:0001992	Process	Regulation of systemic arterial blood pressure by vasopressin	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005000	Function	Vasopressin receptor activity	IBA
GO:0005000	Function	Vasopressin receptor activity	IDA	9322919, 15528211
GO:0005000	Function	Vasopressin receptor activity	IEA
GO:0005000	Function	Vasopressin receptor activity	TAS	7805841
GO:0005080	Function	Protein kinase C binding	IEA
GO:0005080	Function	Protein kinase C binding	TAS	10858434
GO:0005768	Component	Endosome	TAS	10858434
GO:0005794	Component	Golgi apparatus	IDA	15528211
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	15528211, 33713620
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	7805841, 10858434
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IDA	15528211
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	10858434
GO:0007200	Process	Phospholipase C-activating G protein-coupled receptor signaling pathway	IDA	9322919
GO:0007204	Process	Positive regulation of cytosolic calcium ion concentration	TAS	7929452
GO:0008217	Process	Regulation of blood pressure	IEA
GO:0008528	Function	G protein-coupled peptide receptor activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0032870	Process	Cellular response to hormone stimulus	IBA
GO:0042127	Process	Regulation of cell population proliferation	IDA	9322919
GO:0043410	Process	Positive regulation of MAPK cascade	IDA	9322919
GO:0045907	Process	Positive regulation of vasoconstriction	IBA
GO:0046718	Process	Symbiont entry into host cell	IDA	33713620
GO:0060732	Process	Positive regulation of inositol phosphate biosynthetic process	IDA	9322919
GO:0090238	Process	Positive regulation of arachidonate secretion	IDA	9322919
GO:0150104	Process	Transport across blood-brain barrier	NAS	30280653

Other IDs

• MIM: 600264
• HGNC: 896
• e!Ensembl: ENSG00000198049

Protein

• UniProt ID: P47901
• Protein name: Vasopressin V1b receptor (V1bR) (AVPR V1b) (AVPR V3) (Antidiuretic hormone receptor 1b) (Vasopressin V3 receptor)
• Protein function: Receptor for arginine vasopressin. The activity of this receptor is mediated by G proteins which activate a phosphatidyl-inositol-calcium second messenger system.; (Microbial infection) During SARS coronavirus-2/SARS-CoV-2 infection, m
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	51 → 338	7 transmembrane receptor (rhodopsin family)	Family

• Sequence:

  MDSGPLWDANPTPRGTLSAPNATTPWLGRDEELAKVEIGVLATVLVLATGGNLAVLLTLG
  QLGRKRSRMHLFVLHLALTDLAVALFQVLPQLLWDITYRFQGPDLLCRAVKYLQVLSMFA
  STYMLLAMTLDRYLAVCHPLRSLQQPGQSTYLLIAAPWLLAAIFSLPQVFIFSLREVIQG
  SGVLDCWADFGFPWGPRAYLTWTTLAIFVLPVTMLTACYSLICHEICKNLKVKTQAWRVG
  GGGWRTWDRPSPSTLAATTRGLPSRVSSINTISRAKIRTVKMTFVIVLAYIACWAPFFSV
  QMWSVWDKNAPDEDSTNVAFTISMLLGNLNSCCNPWIYMGFNSHLLPRPLRHLACCGGPQ
  PRMRRRLSDGSLSSRHTTLLTRSSCPATLSLSLSLTLSGRPRPEESPRDLELADGEGTAE
  TIIF

• Sequence length: 424

Pathways

KEGG:

Calcium signaling pathway
Phospholipase D signaling pathway
Neuroactive ligand-receptor interaction
Hormone signaling
Vascular smooth muscle contraction

Reactome:

Vasopressin-like receptors
G alpha (q) signalling events
Defective AVP does not bind AVPR1A,B and causes neurohypophyseal diabetes insipidus (NDI)

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER, MOST RECENT EPISODE MANIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSION, BIPOLAR	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIXED BIPOLAR I DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
ACTH Syndrome, Ectopic	Ectopic ACTH secretion syndrome	BEFREE	18426818		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	23422793		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	23422793	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	19486526, 23422793		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety disorder	Pubtator	23422793	Associate	★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	39278467	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	22341483, 23962971, 24012103		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	22341483, 23962971		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	39278467	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congestive heart failure	Congestive Heart Failure	BEFREE	31645268		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	23422793		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	23422793	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	26503846		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	26503846	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	31645268		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	23962971		★☆☆☆☆ Found in Text Mining only
Melancholia	Melancholia	BEFREE	23068076		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	23422793		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	15094789, 17909131, 23962971		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	PSYGENET_DG	15094789, 17909131, 23962971, 24012103		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	21383526, 9876345		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	26503846		★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	18384079		★☆☆☆☆ Found in Text Mining only
Pituitary Diseases	Pituitary Diseases	BEFREE	21383526, 31622604		★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	21908929	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	39501331	Associate	★☆☆☆☆ Found in Text Mining only
Recurrent major depressive episodes	Mental Depression	BEFREE	15094789		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	16043261		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	15613460, 16043261	Associate	★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	23962971		★☆☆☆☆ Found in Text Mining only