Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	55297
Gene name	Coiled-coil domain containing 91
Gene symbol	CCDC91
Synonyms (NCBI Gene)	HSD8p56
Chromosome	12
Chromosome location	12p11.22

140

Show/Hide all (140)

miRTarBase ID	miRNA	Experiments	Reference
MIRT625140	hsa-miR-8485	HITS-CLIP	23824327
MIRT625139	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT625138	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT629246	hsa-miR-5689	HITS-CLIP	23824327
MIRT625140	hsa-miR-8485	HITS-CLIP	23824327
MIRT625139	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT625138	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT629246	hsa-miR-5689	HITS-CLIP	23824327
MIRT625140	hsa-miR-8485	HITS-CLIP	23824327
MIRT625139	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT625138	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT629246	hsa-miR-5689	HITS-CLIP	23824327
MIRT625140	hsa-miR-8485	HITS-CLIP	23824327
MIRT625139	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT625138	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT629246	hsa-miR-5689	HITS-CLIP	23824327
MIRT625140	hsa-miR-8485	HITS-CLIP	23824327
MIRT625139	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT625138	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT625140	hsa-miR-8485	HITS-CLIP	23824327
MIRT625139	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT625138	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT629246	hsa-miR-5689	HITS-CLIP	23824327
MIRT625140	hsa-miR-8485	HITS-CLIP	23824327
MIRT625139	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT625138	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT629246	hsa-miR-5689	HITS-CLIP	23824327
MIRT625140	hsa-miR-8485	HITS-CLIP	23824327
MIRT625139	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT625138	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT629246	hsa-miR-5689	HITS-CLIP	23824327
MIRT625140	hsa-miR-8485	HITS-CLIP	23824327
MIRT625139	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT625138	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT629246	hsa-miR-5689	HITS-CLIP	23824327
MIRT625140	hsa-miR-8485	HITS-CLIP	23824327
MIRT625139	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT625138	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT870405	hsa-miR-1267	CLIP-seq
MIRT870406	hsa-miR-135a	CLIP-seq
MIRT870407	hsa-miR-135b	CLIP-seq
MIRT870408	hsa-miR-142-5p	CLIP-seq
MIRT870409	hsa-miR-188-3p	CLIP-seq
MIRT870410	hsa-miR-203	CLIP-seq
MIRT870411	hsa-miR-3074-3p	CLIP-seq
MIRT870412	hsa-miR-3119	CLIP-seq
MIRT870413	hsa-miR-3140-3p	CLIP-seq
MIRT870414	hsa-miR-335	CLIP-seq
MIRT870415	hsa-miR-340	CLIP-seq
MIRT870416	hsa-miR-361-5p	CLIP-seq
MIRT870417	hsa-miR-3664-5p	CLIP-seq
MIRT870418	hsa-miR-3689a-5p	CLIP-seq
MIRT870419	hsa-miR-3689b	CLIP-seq
MIRT870420	hsa-miR-3689e	CLIP-seq
MIRT870421	hsa-miR-3689f	CLIP-seq
MIRT870422	hsa-miR-369-3p	CLIP-seq
MIRT870423	hsa-miR-374a	CLIP-seq
MIRT870424	hsa-miR-374b	CLIP-seq
MIRT870425	hsa-miR-3973	CLIP-seq
MIRT870426	hsa-miR-410	CLIP-seq
MIRT870427	hsa-miR-4438	CLIP-seq
MIRT870428	hsa-miR-4452	CLIP-seq
MIRT870429	hsa-miR-450b-5p	CLIP-seq
MIRT870430	hsa-miR-4699-3p	CLIP-seq
MIRT870431	hsa-miR-4714-5p	CLIP-seq
MIRT870432	hsa-miR-4775	CLIP-seq
MIRT870433	hsa-miR-487a	CLIP-seq
MIRT870434	hsa-miR-494	CLIP-seq
MIRT870435	hsa-miR-507	CLIP-seq
MIRT870436	hsa-miR-518a-5p	CLIP-seq
MIRT870437	hsa-miR-520g	CLIP-seq
MIRT870438	hsa-miR-520h	CLIP-seq
MIRT870439	hsa-miR-527	CLIP-seq
MIRT870440	hsa-miR-532-3p	CLIP-seq
MIRT870441	hsa-miR-557	CLIP-seq
MIRT870442	hsa-miR-561	CLIP-seq
MIRT870443	hsa-miR-590-3p	CLIP-seq
MIRT870444	hsa-miR-653	CLIP-seq
MIRT1958396	hsa-miR-200b	CLIP-seq
MIRT1958397	hsa-miR-200c	CLIP-seq
MIRT1958398	hsa-miR-429	CLIP-seq
MIRT2195232	hsa-miR-1257	CLIP-seq
MIRT2195233	hsa-miR-181a	CLIP-seq
MIRT2195234	hsa-miR-181b	CLIP-seq
MIRT2195235	hsa-miR-181c	CLIP-seq
MIRT2195236	hsa-miR-181d	CLIP-seq
MIRT2195237	hsa-miR-4262	CLIP-seq
MIRT2195238	hsa-miR-4641	CLIP-seq
MIRT2195239	hsa-miR-4722-3p	CLIP-seq
MIRT2195240	hsa-miR-4793-5p	CLIP-seq
MIRT2195241	hsa-miR-520d-5p	CLIP-seq
MIRT2195242	hsa-miR-524-5p	CLIP-seq
MIRT2195232	hsa-miR-1257	CLIP-seq
MIRT870405	hsa-miR-1267	CLIP-seq
MIRT2498503	hsa-miR-127-5p	CLIP-seq
MIRT2498504	hsa-miR-132	CLIP-seq
MIRT870406	hsa-miR-135a	CLIP-seq
MIRT870407	hsa-miR-135b	CLIP-seq
MIRT870408	hsa-miR-142-5p	CLIP-seq
MIRT2195233	hsa-miR-181a	CLIP-seq
MIRT2195234	hsa-miR-181b	CLIP-seq
MIRT2195235	hsa-miR-181c	CLIP-seq
MIRT2195236	hsa-miR-181d	CLIP-seq
MIRT2498505	hsa-miR-186	CLIP-seq
MIRT870409	hsa-miR-188-3p	CLIP-seq
MIRT2498506	hsa-miR-2052	CLIP-seq
MIRT2498507	hsa-miR-212	CLIP-seq
MIRT870412	hsa-miR-3119	CLIP-seq
MIRT2498508	hsa-miR-3133	CLIP-seq
MIRT870413	hsa-miR-3140-3p	CLIP-seq
MIRT2498509	hsa-miR-3163	CLIP-seq
MIRT2498510	hsa-miR-33a	CLIP-seq
MIRT2498511	hsa-miR-33b	CLIP-seq
MIRT870415	hsa-miR-340	CLIP-seq
MIRT870417	hsa-miR-3664-5p	CLIP-seq
MIRT2498512	hsa-miR-3688-5p	CLIP-seq
MIRT2195237	hsa-miR-4262	CLIP-seq
MIRT2498513	hsa-miR-433	CLIP-seq
MIRT870427	hsa-miR-4438	CLIP-seq
MIRT870428	hsa-miR-4452	CLIP-seq
MIRT2498514	hsa-miR-4495	CLIP-seq
MIRT870429	hsa-miR-450b-5p	CLIP-seq
MIRT870431	hsa-miR-4714-5p	CLIP-seq
MIRT2195239	hsa-miR-4722-3p	CLIP-seq
MIRT870432	hsa-miR-4775	CLIP-seq
MIRT2195240	hsa-miR-4793-5p	CLIP-seq
MIRT870433	hsa-miR-487a	CLIP-seq
MIRT870435	hsa-miR-507	CLIP-seq
MIRT2498515	hsa-miR-548c-3p	CLIP-seq
MIRT870441	hsa-miR-557	CLIP-seq
MIRT870442	hsa-miR-561	CLIP-seq
MIRT870443	hsa-miR-590-3p	CLIP-seq
MIRT2498516	hsa-miR-664	CLIP-seq
MIRT2195232	hsa-miR-1257	CLIP-seq
MIRT2195233	hsa-miR-181a	CLIP-seq
MIRT2195234	hsa-miR-181b	CLIP-seq
MIRT2195235	hsa-miR-181c	CLIP-seq
MIRT2195236	hsa-miR-181d	CLIP-seq
MIRT2195237	hsa-miR-4262	CLIP-seq
MIRT2677515	hsa-miR-4766-5p	CLIP-seq

Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005654	Component	Nucleoplasm	IDA
GO:0005794	Component	Golgi apparatus	IDA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005802	Component	Trans-Golgi network	IBA
GO:0005802	Component	Trans-Golgi network	IDA	17596511
GO:0005829	Component	Cytosol	IEA
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0048193	Process	Golgi vesicle transport	IEA
GO:0090160	Process	Golgi to lysosome transport	IBA
GO:0090160	Process	Golgi to lysosome transport	IMP	17596511

MIM	HGNC	e!Ensembl
617366	24855	ENSG00000123106

Q7Z6B0

Protein name

Coiled-coil domain-containing protein 91 (GGA-binding partner) (p56 accessory protein)

Protein function

Involved in the regulation of membrane traffic through the trans-Golgi network (TGN). Functions in close cooperation with the GGAs in the sorting of hydrolases to lysosomes.

PDB

1OM9

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:12808037}.

Sequence

MDDDDFGGFEAAETFDGGSGETQTTSPAIPWAAFPAVSGVHLSPSSPEIVLDRDHSSSIG
CLSSDAIISSPENTHAANSIVSQTIPKAQIQQSTHTHLDISLFPLGLTDEKSNGTIALVD
DSEDPGANVSNIQLQQKISSLEIKLKVSEEEKQRIKQDVESLMEKHNVLEKGFLKEKEQE
AISFQDRYKELQEKHKQELEDMRKAGHEALSIIVDEYKALLQSSVKQQVEAIEKQYISAI
EKQAHKCEELLNAQHQRLLEMLDTEKELLKEKIKEALIQQSQEQKEILEKCLEEERQRNK
EALVSAAKLEKEAVKDAVLKVVEEERKNLEKAHAEERELWKTEHAKDQEKVSQEIQKAIQ
EQRKISQETVKAAIIEEQKRSEKAVEEAVKRTRDELIEYIKEQKRLDQVIRQRSLSSLEL
FLSCAQKQLSALIATEPVDIE

Sequence length

441

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (38)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GenCC	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESSENTIAL TREMOR	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LARYNGEAL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HAND	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN ENDOMETRIOID CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC OVARY SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEASONAL ALLERGIC RHINITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TRIPLE-NEGATIVE BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (12)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute pancreatitis	Pancreatitis	BEFREE	28984787		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	27459855	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	11765912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	GWASCAT_DG	30804561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	30890645		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperostosis Diffuse Idiopathic Skeletal	Diffuse idiopathic skeletal hyperostosis	Pubtator	37156767	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	30890645		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	26635082	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	BEFREE	20484596		★★★★★ ★☆☆☆☆ Found in Text Mining only
OSSIFICATION OF THE POSTERIOR LONGITUDINAL LIGAMENT OF SPINE	Ossification Of The Posterior Longitudinal Ligament Of Spine	GWASCAT_DG	25064007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	GWASCAT_DG	26284813		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Status Epilepticus	Status Epilepticus	BEFREE	31270158		★★★★★ ★☆☆☆☆ Found in Text Mining only

CCDC91 (coiled-coil domain containing 91)