FBXW7 (F-box and WD repeat domain containing 7)

Gene

• Entrez ID: 55294
• Gene name: F-box and WD repeat domain containing 7
• Gene symbol: FBXW7
• Synonyms (NCBI Gene): AGO, CDC4, DEDHIL, FBW6, FBW7, FBX30, FBXO30, FBXW6, SEL-10, SEL10, hAgo, hCdc4
• Chromosome: 4
• Chromosome location: 4q31.3
• Summary: This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), w

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs149680468	G>A,C,T	Likely-pathogenic	Coding sequence variant, genic downstream transcript variant, missense variant
rs747241612	G>C	Likely-pathogenic	Missense variant, coding sequence variant, genic downstream transcript variant
rs759610249	C>T	Likely-pathogenic	Coding sequence variant, missense variant, genic downstream transcript variant
rs866987936	C>A,G,T	Likely-pathogenic	Genic downstream transcript variant, coding sequence variant, missense variant
rs867384286	G>A,C	Likely-pathogenic	Genic downstream transcript variant, coding sequence variant, missense variant
rs1057519895	C>A,G,T	Likely-pathogenic	Genic downstream transcript variant, coding sequence variant, missense variant
rs1057519896	C>A,T	Likely-pathogenic, uncertain-significance	Genic downstream transcript variant, coding sequence variant, missense variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT004756	hsa-miR-107	Luciferase reporter assay, Microarray, Northern blot, Western blot	20042474
MIRT004757	hsa-miR-128-3p	Luciferase reporter assay, Microarray, Northern blot, Western blot	20042474
MIRT003827	hsa-miR-197-3p	Microarray	16822819
MIRT006237	hsa-miR-223-3p	Luciferase reporter assay, qRT-PCR, Western blot	22270966
MIRT006357	hsa-miR-27a-3p	Luciferase reporter assay, Western blot	21460851
MIRT006357	hsa-miR-27a-3p	Luciferase reporter assay, Western blot	21460851
MIRT006357	hsa-miR-27a-3p	Luciferase reporter assay, Western blot	21460851
MIRT006357	hsa-miR-27a-3p	Luciferase reporter assay, Western blot	21460851
MIRT006357	hsa-miR-27a-3p	Luciferase reporter assay, Western blot	21460851
MIRT006357	hsa-miR-27a-3p	Luciferase reporter assay, Western blot	21460851
MIRT006357	hsa-miR-27a-3p	Luciferase reporter assay, Western blot	21460851
MIRT006357	hsa-miR-27a-3p	Luciferase reporter assay, Western blot	21460851
MIRT006237	hsa-miR-223-3p	Luciferase reporter assay, qRT-PCR, Western blot	22270966
MIRT006357	hsa-miR-27a-3p	Luciferase reporter assay, Western blot	21460851
MIRT006357	hsa-miR-27a-3p	Luciferase reporter assay, Western blot	21460851
MIRT006357	hsa-miR-27a-3p	Luciferase reporter assay, Western blot	21460851
MIRT006357	hsa-miR-27a-3p	Luciferase reporter assay, Western blot	21460851
MIRT006237	hsa-miR-223-3p	Luciferase reporter assay, qRT-PCR, Western blot	22270966
MIRT016198	hsa-miR-590-3p	Sequencing	20371350
MIRT004757	hsa-miR-128-3p	Sequencing	20371350
MIRT027232	hsa-miR-103a-3p	Sequencing	20371350
MIRT027385	hsa-miR-101-3p	Sequencing	20371350
MIRT006357	hsa-miR-27a-3p	Sequencing	20371350
MIRT032006	hsa-miR-16-5p	Sequencing	20371350
MIRT437907	hsa-miR-503-5p	Luciferase reporter assay, Western blot	25269767
MIRT437907	hsa-miR-503-5p	Luciferase reporter assay, Western blot	25269767
MIRT437908	hsa-miR-182-5p	Luciferase reporter assay, Western blot	25269767
MIRT437908	hsa-miR-182-5p	Luciferase reporter assay, Western blot	25269767
MIRT437908	hsa-miR-182-5p	Luciferase reporter assay, Western blot	25269767
MIRT437908	hsa-miR-182-5p	Luciferase reporter assay, Western blot	25269767
MIRT006237	hsa-miR-223-3p	Flow, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	25159729
MIRT006237	hsa-miR-223-3p	Flow, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	25159729
MIRT006237	hsa-miR-223-3p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	25888377
MIRT006237	hsa-miR-223-3p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	25888377
MIRT438342	hsa-miR-25-3p	Luciferase reporter assay, qRT-PCR, Western blot	25944166
MIRT438342	hsa-miR-25-3p	Luciferase reporter assay, qRT-PCR, Western blot	25944166
MIRT006237	hsa-miR-223-3p	Luciferase reporter assay	24324762
MIRT006237	hsa-miR-223-3p	Flow, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	25159729
MIRT006237	hsa-miR-223-3p	Flow, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	25159729
MIRT006237	hsa-miR-223-3p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	25888377
MIRT006237	hsa-miR-223-3p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	25888377
MIRT438342	hsa-miR-25-3p	Luciferase reporter assay, qRT-PCR, Western blot	25944166
MIRT438342	hsa-miR-25-3p	Luciferase reporter assay, qRT-PCR, Western blot	25944166
MIRT006237	hsa-miR-223-3p	Luciferase reporter assay	24324762
MIRT548250	hsa-miR-5694	PAR-CLIP	21572407
MIRT548249	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT548248	hsa-miR-656-3p	PAR-CLIP	21572407
MIRT548247	hsa-miR-4495	PAR-CLIP	21572407
MIRT548246	hsa-miR-379-3p	PAR-CLIP	21572407
MIRT548245	hsa-miR-411-3p	PAR-CLIP	21572407
MIRT548244	hsa-miR-380-3p	PAR-CLIP	21572407
MIRT548242	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT548243	hsa-miR-579-3p	PAR-CLIP	21572407
MIRT548241	hsa-miR-664b-3p	PAR-CLIP	21572407
MIRT548240	hsa-miR-1303	PAR-CLIP	21572407
MIRT476888	hsa-miR-203a-3p	PAR-CLIP	23592263
MIRT476888	hsa-miR-203a-3p	PAR-CLIP	23592263
MIRT476887	hsa-miR-548ag	PAR-CLIP	23592263
MIRT476886	hsa-miR-548ai	PAR-CLIP	23592263
MIRT476885	hsa-miR-548ba	PAR-CLIP	23592263
MIRT476884	hsa-miR-570-5p	PAR-CLIP	23592263
MIRT476883	hsa-miR-4698	PAR-CLIP	23592263
MIRT476882	hsa-miR-4328	PAR-CLIP	23592263
MIRT476881	hsa-miR-2052	PAR-CLIP	23592263
MIRT476880	hsa-miR-4639-5p	PAR-CLIP	23592263
MIRT476879	hsa-miR-510-3p	PAR-CLIP	23592263
MIRT440649	ebv-miR-BART10-3p	HITS-CLIP	22473208
MIRT440649	ebv-miR-BART10-3p	HITS-CLIP	22473208
MIRT438342	hsa-miR-25-3p	Western blot, Immunofluorescence, Immunohistochemistry	25512615
MIRT438342	hsa-miR-25-3p	Western blot, Immunofluorescence, Immunohistochemistry	25512615
MIRT731444	hsa-miR-32-5p	Luciferase reporter assay, qRT-PCR, Western blot	28149200
MIRT731444	hsa-miR-32-5p	Luciferase reporter assay, qRT-PCR, Western blot	28149200
MIRT731599	hsa-miR-92a-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26323375
MIRT731599	hsa-miR-92a-3p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	26323375
MIRT006357	hsa-miR-27a-3p	Luciferase reporter assay, Western blot	26629048
MIRT006357	hsa-miR-27a-3p	Luciferase reporter assay, Western blot	26629048
MIRT732430	hsa-miR-384	Luciferase reporter assay, qRT-PCR, Western blot	27769041
MIRT732430	hsa-miR-384	Luciferase reporter assay, qRT-PCR, Western blot	27769041
MIRT737154	hsa-miR-182-3p	Luciferase reporter assay, qRT-PCR, Western blot	27648365
MIRT731599	hsa-miR-92a-3p	Luciferase reporter assay, qRT-PCR, Western blot	28069547
MIRT438342	hsa-miR-25-3p	Luciferase reporter assay, Western blot	26464659
MIRT438342	hsa-miR-25-3p	Luciferase reporter assay, Western blot	26464659
MIRT438342	hsa-miR-25-3p	Luciferase reporter assay, Western blot	26464659
MIRT438342	hsa-miR-25-3p	Luciferase reporter assay, Western blot	26464659
MIRT438342	hsa-miR-25-3p	Luciferase reporter assay, Western blot	26464659
MIRT438342	hsa-miR-25-3p	Luciferase reporter assay, Western blot	26464659
MIRT438342	hsa-miR-25-3p	Luciferase reporter assay, Western blot	26464659
MIRT438342	hsa-miR-25-3p	Luciferase reporter assay, Western blot	26464659
MIRT438342	hsa-miR-25-3p	Luciferase reporter assay, Western blot	26464659
MIRT438342	hsa-miR-25-3p	Luciferase reporter assay, Western blot	26464659
MIRT438342	hsa-miR-25-3p	Luciferase reporter assay, Western blot	26464659
MIRT438342	hsa-miR-25-3p	Luciferase reporter assay, Western blot	26464659
MIRT438342	hsa-miR-25-3p	Luciferase reporter assay, Western blot	26464659
MIRT438342	hsa-miR-25-3p	Luciferase reporter assay, Western blot	26464659
MIRT438342	hsa-miR-25-3p	Luciferase reporter assay, Western blot	26464659
MIRT006237	hsa-miR-223-3p	qRT-PCR, Western blot	28000896
MIRT027385	hsa-miR-101-3p	PAR-CLIP	26701625
MIRT027385	hsa-miR-101-3p	PAR-CLIP	26701625
MIRT027385	hsa-miR-101-3p	PAR-CLIP	26701625
MIRT027385	hsa-miR-101-3p	PAR-CLIP	26701625
MIRT027385	hsa-miR-101-3p	PAR-CLIP	26701625
MIRT027385	hsa-miR-101-3p	PAR-CLIP	26701625
MIRT027385	hsa-miR-101-3p	PAR-CLIP	26701625
MIRT027385	hsa-miR-101-3p	PAR-CLIP	26701625
MIRT027385	hsa-miR-101-3p	PAR-CLIP	26701625
MIRT737058	hsa-miR-144-3p	PAR-CLIP	26701625
MIRT737058	hsa-miR-144-3p	PAR-CLIP	26701625
MIRT737058	hsa-miR-144-3p	PAR-CLIP	26701625
MIRT737058	hsa-miR-144-3p	PAR-CLIP	26701625
MIRT737058	hsa-miR-144-3p	PAR-CLIP	26701625
MIRT737058	hsa-miR-144-3p	PAR-CLIP	26701625
MIRT737058	hsa-miR-144-3p	PAR-CLIP	26701625
MIRT737058	hsa-miR-144-3p	PAR-CLIP	26701625
MIRT737058	hsa-miR-144-3p	PAR-CLIP	26701625
MIRT027385	hsa-miR-101-3p	PAR-CLIP	27292025
MIRT737058	hsa-miR-144-3p	PAR-CLIP	27292025
MIRT438342	hsa-miR-25-3p	Immunoprecipitaion (IP), Luciferase reporter assay, qRT-PCR, Western blotting	34278448
MIRT438342	hsa-miR-25-3p	Immunoprecipitaion (IP), Luciferase reporter assay, qRT-PCR, Western blotting	34278448
MIRT438342	hsa-miR-25-3p	Immunoprecipitaion (IP), Luciferase reporter assay, qRT-PCR, Western blotting	34278448
MIRT006357	hsa-miR-27a-3p	Immunofluorescence, Luciferase reporter assay, Microarray, qRT-PCR, Western blotting	32159214
MIRT027385	hsa-miR-101-3p	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), qRT-PCR	33438204
MIRT735235	hsa-miR-500a-3p	Luciferase reporter assay, Western blotting, Immunofluorescence, qRT-PCR	32588541
MIRT731599	hsa-miR-92a-3p	Luciferase reporter assay, Western blotting, qRT-PCR	32945381
MIRT438342	hsa-miR-25-3p	qRT-PCR, Immunocytochemistry (ICC)	33886022
MIRT737058	hsa-miR-144-3p	Luciferase reporter assay, Western blotting, qRT-PCR, ELISA	34094717
MIRT737154	hsa-miR-182-3p	Microarray	33884382
MIRT548250	hsa-miR-5694	PAR-CLIP	21572407
MIRT548249	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT548248	hsa-miR-656-3p	PAR-CLIP	21572407
MIRT548247	hsa-miR-4495	PAR-CLIP	21572407
MIRT548246	hsa-miR-379-3p	PAR-CLIP	21572407
MIRT548245	hsa-miR-411-3p	PAR-CLIP	21572407
MIRT548244	hsa-miR-380-3p	PAR-CLIP	21572407
MIRT548242	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT548243	hsa-miR-579-3p	PAR-CLIP	21572407
MIRT548241	hsa-miR-664b-3p	PAR-CLIP	21572407
MIRT548240	hsa-miR-1303	PAR-CLIP	21572407
MIRT476888	hsa-miR-203a-3p	PAR-CLIP	23592263
MIRT476888	hsa-miR-203a-3p	PAR-CLIP	23592263
MIRT476887	hsa-miR-548ag	PAR-CLIP	23592263
MIRT476886	hsa-miR-548ai	PAR-CLIP	23592263
MIRT476885	hsa-miR-548ba	PAR-CLIP	23592263
MIRT476884	hsa-miR-570-5p	PAR-CLIP	23592263
MIRT476883	hsa-miR-4698	PAR-CLIP	23592263
MIRT476882	hsa-miR-4328	PAR-CLIP	23592263
MIRT476881	hsa-miR-2052	PAR-CLIP	23592263
MIRT476880	hsa-miR-4639-5p	PAR-CLIP	23592263
MIRT476879	hsa-miR-510-3p	PAR-CLIP	23592263
MIRT027232	hsa-miR-103a-3p	Luciferase reporter assay, Western blotting, qRT-PCR	35094292
MIRT755914	hsa-miR-92b-3p	Luciferase reporter assay, Western blotting, qRT-PCR	37752997
MIRT993463	hsa-miR-101	CLIP-seq
MIRT993464	hsa-miR-1238	CLIP-seq
MIRT993465	hsa-miR-144	CLIP-seq
MIRT993466	hsa-miR-188-5p	CLIP-seq
MIRT993467	hsa-miR-200b	CLIP-seq
MIRT993468	hsa-miR-200c	CLIP-seq
MIRT993469	hsa-miR-204	CLIP-seq
MIRT993470	hsa-miR-211	CLIP-seq
MIRT993471	hsa-miR-223	CLIP-seq
MIRT993472	hsa-miR-3187-3p	CLIP-seq
MIRT993473	hsa-miR-3192	CLIP-seq
MIRT993474	hsa-miR-3975	CLIP-seq
MIRT993475	hsa-miR-429	CLIP-seq
MIRT993476	hsa-miR-4318	CLIP-seq
MIRT993477	hsa-miR-4435	CLIP-seq
MIRT993478	hsa-miR-4679	CLIP-seq
MIRT993479	hsa-miR-4691-5p	CLIP-seq
MIRT993480	hsa-miR-4693-5p	CLIP-seq
MIRT993481	hsa-miR-4697-3p	CLIP-seq
MIRT993482	hsa-miR-489	CLIP-seq
MIRT993483	hsa-miR-548m	CLIP-seq
MIRT993484	hsa-miR-548s	CLIP-seq
MIRT993485	hsa-miR-892a	CLIP-seq
MIRT993463	hsa-miR-101	CLIP-seq
MIRT993486	hsa-miR-103a	CLIP-seq
MIRT993487	hsa-miR-1226	CLIP-seq
MIRT993488	hsa-miR-1236	CLIP-seq
MIRT993489	hsa-miR-1267	CLIP-seq
MIRT993490	hsa-miR-1270	CLIP-seq
MIRT993491	hsa-miR-128	CLIP-seq
MIRT993492	hsa-miR-1290	CLIP-seq
MIRT993493	hsa-miR-1298	CLIP-seq
MIRT993494	hsa-miR-1305	CLIP-seq
MIRT993495	hsa-miR-137	CLIP-seq
MIRT993465	hsa-miR-144	CLIP-seq
MIRT993496	hsa-miR-146a	CLIP-seq
MIRT993497	hsa-miR-146b-5p	CLIP-seq
MIRT993498	hsa-miR-15a	CLIP-seq
MIRT993499	hsa-miR-15b	CLIP-seq
MIRT993500	hsa-miR-16	CLIP-seq
MIRT993501	hsa-miR-1827	CLIP-seq
MIRT993502	hsa-miR-195	CLIP-seq
MIRT993467	hsa-miR-200b	CLIP-seq
MIRT993468	hsa-miR-200c	CLIP-seq
MIRT993503	hsa-miR-219-1-3p	CLIP-seq
MIRT993471	hsa-miR-223	CLIP-seq
MIRT993504	hsa-miR-25	CLIP-seq
MIRT993505	hsa-miR-27a	CLIP-seq
MIRT993506	hsa-miR-27b	CLIP-seq
MIRT993507	hsa-miR-29a	CLIP-seq
MIRT993508	hsa-miR-29b	CLIP-seq
MIRT993509	hsa-miR-29c	CLIP-seq
MIRT993510	hsa-miR-3121-3p	CLIP-seq
MIRT993511	hsa-miR-3130-3p	CLIP-seq
MIRT993512	hsa-miR-3136-5p	CLIP-seq
MIRT993513	hsa-miR-3137	CLIP-seq
MIRT993514	hsa-miR-3145-3p	CLIP-seq
MIRT993515	hsa-miR-3183	CLIP-seq
MIRT993472	hsa-miR-3187-3p	CLIP-seq
MIRT993516	hsa-miR-3189-5p	CLIP-seq
MIRT993473	hsa-miR-3192	CLIP-seq
MIRT993517	hsa-miR-32	CLIP-seq
MIRT993518	hsa-miR-3200-5p	CLIP-seq
MIRT993519	hsa-miR-338-3p	CLIP-seq
MIRT993520	hsa-miR-3609	CLIP-seq
MIRT993521	hsa-miR-363	CLIP-seq
MIRT993522	hsa-miR-3655	CLIP-seq
MIRT993523	hsa-miR-367	CLIP-seq
MIRT993524	hsa-miR-3682-5p	CLIP-seq
MIRT993525	hsa-miR-3688-3p	CLIP-seq
MIRT993474	hsa-miR-3975	CLIP-seq
MIRT993526	hsa-miR-424	CLIP-seq
MIRT993527	hsa-miR-4251	CLIP-seq
MIRT993528	hsa-miR-4264	CLIP-seq
MIRT993475	hsa-miR-429	CLIP-seq
MIRT993529	hsa-miR-4290	CLIP-seq
MIRT993476	hsa-miR-4318	CLIP-seq
MIRT993530	hsa-miR-432	CLIP-seq
MIRT993531	hsa-miR-4423-5p	CLIP-seq
MIRT993532	hsa-miR-4434	CLIP-seq
MIRT993477	hsa-miR-4435	CLIP-seq
MIRT993533	hsa-miR-4439	CLIP-seq
MIRT993534	hsa-miR-4470	CLIP-seq
MIRT993535	hsa-miR-4474-3p	CLIP-seq
MIRT993536	hsa-miR-4474-5p	CLIP-seq
MIRT993537	hsa-miR-4516	CLIP-seq
MIRT993538	hsa-miR-452	CLIP-seq
MIRT993539	hsa-miR-4524	CLIP-seq
MIRT993540	hsa-miR-4531	CLIP-seq
MIRT993541	hsa-miR-4639-3p	CLIP-seq
MIRT993542	hsa-miR-4676-3p	CLIP-seq
MIRT993478	hsa-miR-4679	CLIP-seq
MIRT993480	hsa-miR-4693-5p	CLIP-seq
MIRT993481	hsa-miR-4697-3p	CLIP-seq
MIRT993543	hsa-miR-4704-3p	CLIP-seq
MIRT993544	hsa-miR-4709-3p	CLIP-seq
MIRT993545	hsa-miR-4709-5p	CLIP-seq
MIRT993546	hsa-miR-4712-5p	CLIP-seq
MIRT993547	hsa-miR-4723-3p	CLIP-seq
MIRT993548	hsa-miR-4729	CLIP-seq
MIRT993549	hsa-miR-4738-3p	CLIP-seq
MIRT993550	hsa-miR-4758-3p	CLIP-seq
MIRT993551	hsa-miR-4766-5p	CLIP-seq
MIRT993552	hsa-miR-4775	CLIP-seq
MIRT993553	hsa-miR-4786-3p	CLIP-seq
MIRT993554	hsa-miR-4793-5p	CLIP-seq
MIRT993555	hsa-miR-4795-3p	CLIP-seq
MIRT993482	hsa-miR-489	CLIP-seq
MIRT993556	hsa-miR-497	CLIP-seq
MIRT993557	hsa-miR-503	CLIP-seq
MIRT993558	hsa-miR-507	CLIP-seq
MIRT993559	hsa-miR-513a-5p	CLIP-seq
MIRT993560	hsa-miR-548ah	CLIP-seq
MIRT993484	hsa-miR-548s	CLIP-seq
MIRT993561	hsa-miR-548t	CLIP-seq
MIRT993562	hsa-miR-557	CLIP-seq
MIRT993563	hsa-miR-571	CLIP-seq
MIRT993564	hsa-miR-577	CLIP-seq
MIRT993565	hsa-miR-579	CLIP-seq
MIRT993566	hsa-miR-584	CLIP-seq
MIRT993567	hsa-miR-589	CLIP-seq
MIRT993568	hsa-miR-603	CLIP-seq
MIRT993569	hsa-miR-620	CLIP-seq
MIRT993570	hsa-miR-634	CLIP-seq
MIRT993571	hsa-miR-646	CLIP-seq
MIRT993572	hsa-miR-656	CLIP-seq
MIRT993573	hsa-miR-671-5p	CLIP-seq
MIRT993574	hsa-miR-760	CLIP-seq
MIRT993575	hsa-miR-767-5p	CLIP-seq
MIRT993485	hsa-miR-892a	CLIP-seq
MIRT993576	hsa-miR-92a	CLIP-seq
MIRT993577	hsa-miR-92b	CLIP-seq
MIRT993578	hsa-miR-935	CLIP-seq
MIRT993579	hsa-miR-943	CLIP-seq
MIRT993463	hsa-miR-101	CLIP-seq
MIRT1994684	hsa-miR-132	CLIP-seq
MIRT993465	hsa-miR-144	CLIP-seq
MIRT1994685	hsa-miR-194	CLIP-seq
MIRT1994686	hsa-miR-212	CLIP-seq
MIRT993471	hsa-miR-223	CLIP-seq
MIRT993472	hsa-miR-3187-3p	CLIP-seq
MIRT993473	hsa-miR-3192	CLIP-seq
MIRT993532	hsa-miR-4434	CLIP-seq
MIRT993477	hsa-miR-4435	CLIP-seq
MIRT1994687	hsa-miR-4446-5p	CLIP-seq
MIRT993534	hsa-miR-4470	CLIP-seq
MIRT1994688	hsa-miR-4501	CLIP-seq
MIRT993537	hsa-miR-4516	CLIP-seq
MIRT993540	hsa-miR-4531	CLIP-seq
MIRT993481	hsa-miR-4697-3p	CLIP-seq
MIRT1994689	hsa-miR-4715-3p	CLIP-seq
MIRT993558	hsa-miR-507	CLIP-seq
MIRT1994690	hsa-miR-548a-3p	CLIP-seq
MIRT1994691	hsa-miR-548e	CLIP-seq
MIRT1994692	hsa-miR-548f	CLIP-seq
MIRT1994693	hsa-miR-548g	CLIP-seq
MIRT993484	hsa-miR-548s	CLIP-seq
MIRT993562	hsa-miR-557	CLIP-seq
MIRT993463	hsa-miR-101	CLIP-seq
MIRT993486	hsa-miR-103a	CLIP-seq
MIRT2228777	hsa-miR-1183	CLIP-seq
MIRT993487	hsa-miR-1226	CLIP-seq
MIRT993489	hsa-miR-1267	CLIP-seq
MIRT2228778	hsa-miR-129-5p	CLIP-seq
MIRT993495	hsa-miR-137	CLIP-seq
MIRT993465	hsa-miR-144	CLIP-seq
MIRT993498	hsa-miR-15a	CLIP-seq
MIRT993499	hsa-miR-15b	CLIP-seq
MIRT993500	hsa-miR-16	CLIP-seq
MIRT2228779	hsa-miR-182	CLIP-seq
MIRT993502	hsa-miR-195	CLIP-seq
MIRT993467	hsa-miR-200b	CLIP-seq
MIRT993468	hsa-miR-200c	CLIP-seq
MIRT993503	hsa-miR-219-1-3p	CLIP-seq
MIRT2228780	hsa-miR-22	CLIP-seq
MIRT993471	hsa-miR-223	CLIP-seq
MIRT993504	hsa-miR-25	CLIP-seq
MIRT993507	hsa-miR-29a	CLIP-seq
MIRT993508	hsa-miR-29b	CLIP-seq
MIRT993509	hsa-miR-29c	CLIP-seq
MIRT993514	hsa-miR-3145-3p	CLIP-seq
MIRT993515	hsa-miR-3183	CLIP-seq
MIRT993472	hsa-miR-3187-3p	CLIP-seq
MIRT993516	hsa-miR-3189-5p	CLIP-seq
MIRT993473	hsa-miR-3192	CLIP-seq
MIRT2228781	hsa-miR-3199	CLIP-seq
MIRT993517	hsa-miR-32	CLIP-seq
MIRT2228782	hsa-miR-320a	CLIP-seq
MIRT2228783	hsa-miR-320b	CLIP-seq
MIRT2228784	hsa-miR-320c	CLIP-seq
MIRT2228785	hsa-miR-320d	CLIP-seq
MIRT993519	hsa-miR-338-3p	CLIP-seq
MIRT2228786	hsa-miR-3607-3p	CLIP-seq
MIRT993520	hsa-miR-3609	CLIP-seq
MIRT993521	hsa-miR-363	CLIP-seq
MIRT993522	hsa-miR-3655	CLIP-seq
MIRT993523	hsa-miR-367	CLIP-seq
MIRT993524	hsa-miR-3682-5p	CLIP-seq
MIRT993474	hsa-miR-3975	CLIP-seq
MIRT993526	hsa-miR-424	CLIP-seq
MIRT993528	hsa-miR-4264	CLIP-seq
MIRT993475	hsa-miR-429	CLIP-seq
MIRT993529	hsa-miR-4290	CLIP-seq
MIRT2228787	hsa-miR-4314	CLIP-seq
MIRT993476	hsa-miR-4318	CLIP-seq
MIRT993531	hsa-miR-4423-5p	CLIP-seq
MIRT2228788	hsa-miR-4429	CLIP-seq
MIRT993477	hsa-miR-4435	CLIP-seq
MIRT2228789	hsa-miR-4436a	CLIP-seq
MIRT1994687	hsa-miR-4446-5p	CLIP-seq
MIRT993534	hsa-miR-4470	CLIP-seq
MIRT993535	hsa-miR-4474-3p	CLIP-seq
MIRT2228790	hsa-miR-450b-5p	CLIP-seq
MIRT993539	hsa-miR-4524	CLIP-seq
MIRT2228791	hsa-miR-4646-5p	CLIP-seq
MIRT993478	hsa-miR-4679	CLIP-seq
MIRT993480	hsa-miR-4693-5p	CLIP-seq
MIRT993481	hsa-miR-4697-3p	CLIP-seq
MIRT993543	hsa-miR-4704-3p	CLIP-seq
MIRT993544	hsa-miR-4709-3p	CLIP-seq
MIRT993546	hsa-miR-4712-5p	CLIP-seq
MIRT993547	hsa-miR-4723-3p	CLIP-seq
MIRT993548	hsa-miR-4729	CLIP-seq
MIRT2228792	hsa-miR-4742-5p	CLIP-seq
MIRT993550	hsa-miR-4758-3p	CLIP-seq
MIRT993552	hsa-miR-4775	CLIP-seq
MIRT993555	hsa-miR-4795-3p	CLIP-seq
MIRT993482	hsa-miR-489	CLIP-seq
MIRT993556	hsa-miR-497	CLIP-seq
MIRT993557	hsa-miR-503	CLIP-seq
MIRT2228793	hsa-miR-518a-5p	CLIP-seq
MIRT2228794	hsa-miR-527	CLIP-seq
MIRT2228795	hsa-miR-548ad	CLIP-seq
MIRT993560	hsa-miR-548ah	CLIP-seq
MIRT993484	hsa-miR-548s	CLIP-seq
MIRT993561	hsa-miR-548t	CLIP-seq
MIRT993563	hsa-miR-571	CLIP-seq
MIRT993564	hsa-miR-577	CLIP-seq
MIRT993565	hsa-miR-579	CLIP-seq
MIRT993566	hsa-miR-584	CLIP-seq
MIRT2228796	hsa-miR-605	CLIP-seq
MIRT2228797	hsa-miR-622	CLIP-seq
MIRT993570	hsa-miR-634	CLIP-seq
MIRT993571	hsa-miR-646	CLIP-seq
MIRT993572	hsa-miR-656	CLIP-seq
MIRT993574	hsa-miR-760	CLIP-seq
MIRT993485	hsa-miR-892a	CLIP-seq
MIRT2228798	hsa-miR-922	CLIP-seq
MIRT993576	hsa-miR-92a	CLIP-seq
MIRT993577	hsa-miR-92b	CLIP-seq
MIRT993578	hsa-miR-935	CLIP-seq
MIRT2387955	hsa-miR-140-3p	CLIP-seq
MIRT2387956	hsa-miR-197	CLIP-seq
MIRT993463	hsa-miR-101	CLIP-seq
MIRT993465	hsa-miR-144	CLIP-seq
MIRT993473	hsa-miR-3192	CLIP-seq
MIRT2532339	hsa-miR-1	CLIP-seq
MIRT993463	hsa-miR-101	CLIP-seq
MIRT993486	hsa-miR-103a	CLIP-seq
MIRT993488	hsa-miR-1236	CLIP-seq
MIRT993464	hsa-miR-1238	CLIP-seq
MIRT2532340	hsa-miR-1264	CLIP-seq
MIRT993490	hsa-miR-1270	CLIP-seq
MIRT993491	hsa-miR-128	CLIP-seq
MIRT2228778	hsa-miR-129-5p	CLIP-seq
MIRT993465	hsa-miR-144	CLIP-seq
MIRT993498	hsa-miR-15a	CLIP-seq
MIRT993499	hsa-miR-15b	CLIP-seq
MIRT993500	hsa-miR-16	CLIP-seq
MIRT993501	hsa-miR-1827	CLIP-seq
MIRT993466	hsa-miR-188-5p	CLIP-seq
MIRT993502	hsa-miR-195	CLIP-seq
MIRT993467	hsa-miR-200b	CLIP-seq
MIRT993468	hsa-miR-200c	CLIP-seq
MIRT993469	hsa-miR-204	CLIP-seq
MIRT2532341	hsa-miR-206	CLIP-seq
MIRT993470	hsa-miR-211	CLIP-seq
MIRT2532342	hsa-miR-2113	CLIP-seq
MIRT993503	hsa-miR-219-1-3p	CLIP-seq
MIRT2532343	hsa-miR-219-5p	CLIP-seq
MIRT2532344	hsa-miR-2278	CLIP-seq
MIRT2532345	hsa-miR-24	CLIP-seq
MIRT993505	hsa-miR-27a	CLIP-seq
MIRT993506	hsa-miR-27b	CLIP-seq
MIRT993507	hsa-miR-29a	CLIP-seq
MIRT993508	hsa-miR-29b	CLIP-seq
MIRT993509	hsa-miR-29c	CLIP-seq
MIRT2532346	hsa-miR-3064-3p	CLIP-seq
MIRT993510	hsa-miR-3121-3p	CLIP-seq
MIRT2532347	hsa-miR-3129-3p	CLIP-seq
MIRT993512	hsa-miR-3136-5p	CLIP-seq
MIRT2532348	hsa-miR-3140-3p	CLIP-seq
MIRT2532349	hsa-miR-3173-3p	CLIP-seq
MIRT2532350	hsa-miR-3185	CLIP-seq
MIRT993472	hsa-miR-3187-3p	CLIP-seq
MIRT993473	hsa-miR-3192	CLIP-seq
MIRT2228781	hsa-miR-3199	CLIP-seq
MIRT993518	hsa-miR-3200-5p	CLIP-seq
MIRT2532351	hsa-miR-33a	CLIP-seq
MIRT2532352	hsa-miR-33b	CLIP-seq
MIRT2532353	hsa-miR-3613-3p	CLIP-seq
MIRT2532354	hsa-miR-3673	CLIP-seq
MIRT993524	hsa-miR-3682-5p	CLIP-seq
MIRT993525	hsa-miR-3688-3p	CLIP-seq
MIRT2532355	hsa-miR-3688-5p	CLIP-seq
MIRT2532356	hsa-miR-3920	CLIP-seq
MIRT993474	hsa-miR-3975	CLIP-seq
MIRT993526	hsa-miR-424	CLIP-seq
MIRT2532357	hsa-miR-4276	CLIP-seq
MIRT2532358	hsa-miR-4282	CLIP-seq
MIRT2532359	hsa-miR-4284	CLIP-seq
MIRT993475	hsa-miR-429	CLIP-seq
MIRT2228787	hsa-miR-4314	CLIP-seq
MIRT993476	hsa-miR-4318	CLIP-seq
MIRT993530	hsa-miR-432	CLIP-seq
MIRT993532	hsa-miR-4434	CLIP-seq
MIRT993477	hsa-miR-4435	CLIP-seq
MIRT2228789	hsa-miR-4436a	CLIP-seq
MIRT993533	hsa-miR-4439	CLIP-seq
MIRT2532360	hsa-miR-4445	CLIP-seq
MIRT993534	hsa-miR-4470	CLIP-seq
MIRT993535	hsa-miR-4474-3p	CLIP-seq
MIRT2532361	hsa-miR-4494	CLIP-seq
MIRT993537	hsa-miR-4516	CLIP-seq
MIRT993538	hsa-miR-452	CLIP-seq
MIRT993539	hsa-miR-4524	CLIP-seq
MIRT993540	hsa-miR-4531	CLIP-seq
MIRT993541	hsa-miR-4639-3p	CLIP-seq
MIRT2228791	hsa-miR-4646-5p	CLIP-seq
MIRT993542	hsa-miR-4676-3p	CLIP-seq
MIRT993478	hsa-miR-4679	CLIP-seq
MIRT993479	hsa-miR-4691-5p	CLIP-seq
MIRT993480	hsa-miR-4693-5p	CLIP-seq
MIRT993481	hsa-miR-4697-3p	CLIP-seq
MIRT993544	hsa-miR-4709-3p	CLIP-seq
MIRT993545	hsa-miR-4709-5p	CLIP-seq
MIRT1994689	hsa-miR-4715-3p	CLIP-seq
MIRT993548	hsa-miR-4729	CLIP-seq
MIRT993549	hsa-miR-4738-3p	CLIP-seq
MIRT2228792	hsa-miR-4742-5p	CLIP-seq
MIRT993551	hsa-miR-4766-5p	CLIP-seq
MIRT2532362	hsa-miR-4773	CLIP-seq
MIRT993552	hsa-miR-4775	CLIP-seq
MIRT2532363	hsa-miR-4782-3p	CLIP-seq
MIRT993555	hsa-miR-4795-3p	CLIP-seq
MIRT2532364	hsa-miR-495	CLIP-seq
MIRT993556	hsa-miR-497	CLIP-seq
MIRT2532365	hsa-miR-499a-5p	CLIP-seq
MIRT993557	hsa-miR-503	CLIP-seq
MIRT993558	hsa-miR-507	CLIP-seq
MIRT2532366	hsa-miR-508-3p	CLIP-seq
MIRT993559	hsa-miR-513a-5p	CLIP-seq
MIRT2532367	hsa-miR-515-5p	CLIP-seq
MIRT2228795	hsa-miR-548ad	CLIP-seq
MIRT993483	hsa-miR-548m	CLIP-seq
MIRT993484	hsa-miR-548s	CLIP-seq
MIRT2532368	hsa-miR-549	CLIP-seq
MIRT993562	hsa-miR-557	CLIP-seq
MIRT2532369	hsa-miR-561	CLIP-seq
MIRT993563	hsa-miR-571	CLIP-seq
MIRT993564	hsa-miR-577	CLIP-seq
MIRT993565	hsa-miR-579	CLIP-seq
MIRT2532370	hsa-miR-586	CLIP-seq
MIRT2532371	hsa-miR-587	CLIP-seq
MIRT2532372	hsa-miR-599	CLIP-seq
MIRT993568	hsa-miR-603	CLIP-seq
MIRT2532373	hsa-miR-613	CLIP-seq
MIRT993569	hsa-miR-620	CLIP-seq
MIRT2228797	hsa-miR-622	CLIP-seq
MIRT993570	hsa-miR-634	CLIP-seq
MIRT993571	hsa-miR-646	CLIP-seq
MIRT993573	hsa-miR-671-5p	CLIP-seq
MIRT993574	hsa-miR-760	CLIP-seq
MIRT2532374	hsa-miR-877	CLIP-seq
MIRT993485	hsa-miR-892a	CLIP-seq
MIRT2228798	hsa-miR-922	CLIP-seq
MIRT993579	hsa-miR-943	CLIP-seq
MIRT993463	hsa-miR-101	CLIP-seq
MIRT993486	hsa-miR-103a	CLIP-seq
MIRT993488	hsa-miR-1236	CLIP-seq
MIRT993464	hsa-miR-1238	CLIP-seq
MIRT2532340	hsa-miR-1264	CLIP-seq
MIRT993490	hsa-miR-1270	CLIP-seq
MIRT993491	hsa-miR-128	CLIP-seq
MIRT993465	hsa-miR-144	CLIP-seq
MIRT993498	hsa-miR-15a	CLIP-seq
MIRT993499	hsa-miR-15b	CLIP-seq
MIRT993500	hsa-miR-16	CLIP-seq
MIRT993501	hsa-miR-1827	CLIP-seq
MIRT993466	hsa-miR-188-5p	CLIP-seq
MIRT993502	hsa-miR-195	CLIP-seq
MIRT993469	hsa-miR-204	CLIP-seq
MIRT993470	hsa-miR-211	CLIP-seq
MIRT993503	hsa-miR-219-1-3p	CLIP-seq
MIRT2532343	hsa-miR-219-5p	CLIP-seq
MIRT2532345	hsa-miR-24	CLIP-seq
MIRT993505	hsa-miR-27a	CLIP-seq
MIRT993506	hsa-miR-27b	CLIP-seq
MIRT2532346	hsa-miR-3064-3p	CLIP-seq
MIRT993510	hsa-miR-3121-3p	CLIP-seq
MIRT2532347	hsa-miR-3129-3p	CLIP-seq
MIRT993512	hsa-miR-3136-5p	CLIP-seq
MIRT2532348	hsa-miR-3140-3p	CLIP-seq
MIRT2532350	hsa-miR-3185	CLIP-seq
MIRT993472	hsa-miR-3187-3p	CLIP-seq
MIRT993473	hsa-miR-3192	CLIP-seq
MIRT2532351	hsa-miR-33a	CLIP-seq
MIRT2532352	hsa-miR-33b	CLIP-seq
MIRT993525	hsa-miR-3688-3p	CLIP-seq
MIRT2532355	hsa-miR-3688-5p	CLIP-seq
MIRT2532356	hsa-miR-3920	CLIP-seq
MIRT993474	hsa-miR-3975	CLIP-seq
MIRT993526	hsa-miR-424	CLIP-seq
MIRT2532357	hsa-miR-4276	CLIP-seq
MIRT2532358	hsa-miR-4282	CLIP-seq
MIRT2532359	hsa-miR-4284	CLIP-seq
MIRT993530	hsa-miR-432	CLIP-seq
MIRT993532	hsa-miR-4434	CLIP-seq
MIRT993477	hsa-miR-4435	CLIP-seq
MIRT2228789	hsa-miR-4436a	CLIP-seq
MIRT993533	hsa-miR-4439	CLIP-seq
MIRT2532360	hsa-miR-4445	CLIP-seq
MIRT993534	hsa-miR-4470	CLIP-seq
MIRT993535	hsa-miR-4474-3p	CLIP-seq
MIRT2532361	hsa-miR-4494	CLIP-seq
MIRT993537	hsa-miR-4516	CLIP-seq
MIRT993539	hsa-miR-4524	CLIP-seq
MIRT993540	hsa-miR-4531	CLIP-seq
MIRT993479	hsa-miR-4691-5p	CLIP-seq
MIRT993544	hsa-miR-4709-3p	CLIP-seq
MIRT993545	hsa-miR-4709-5p	CLIP-seq
MIRT1994689	hsa-miR-4715-3p	CLIP-seq
MIRT993548	hsa-miR-4729	CLIP-seq
MIRT993549	hsa-miR-4738-3p	CLIP-seq
MIRT2532363	hsa-miR-4782-3p	CLIP-seq
MIRT2532364	hsa-miR-495	CLIP-seq
MIRT993556	hsa-miR-497	CLIP-seq
MIRT2532365	hsa-miR-499a-5p	CLIP-seq
MIRT993557	hsa-miR-503	CLIP-seq
MIRT2532366	hsa-miR-508-3p	CLIP-seq
MIRT993559	hsa-miR-513a-5p	CLIP-seq
MIRT2228795	hsa-miR-548ad	CLIP-seq
MIRT993483	hsa-miR-548m	CLIP-seq
MIRT993484	hsa-miR-548s	CLIP-seq
MIRT2532368	hsa-miR-549	CLIP-seq
MIRT993563	hsa-miR-571	CLIP-seq
MIRT993565	hsa-miR-579	CLIP-seq
MIRT2532370	hsa-miR-586	CLIP-seq
MIRT2532371	hsa-miR-587	CLIP-seq
MIRT993569	hsa-miR-620	CLIP-seq
MIRT993571	hsa-miR-646	CLIP-seq
MIRT993573	hsa-miR-671-5p	CLIP-seq
MIRT993574	hsa-miR-760	CLIP-seq
MIRT2532374	hsa-miR-877	CLIP-seq
MIRT2228798	hsa-miR-922	CLIP-seq
MIRT993579	hsa-miR-943	CLIP-seq
MIRT993473	hsa-miR-3192	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000082	Process	G1/S transition of mitotic cell cycle	IDA	25438055
GO:0001944	Process	Vasculature development	IEA
GO:0001944	Process	Vasculature development	TAS	21123947
GO:0005515	Function	Protein binding	IPI	15070733, 15103331, 17157259, 17314511, 17558397, 17873522, 17909182, 19111882, 19412162, 20596027, 20823234, 21145461, 21620836, 22307056, 22939624, 23022380, 23082202, 23108047, 23791182, 24000165, 24344117, 24412244, 25344755, 25775507, 25897075, 27229929, 27238018, 27458189, 278
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	17558397
GO:0005634	Component	Nucleus	IDA	28007894
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA	17558397
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0005730	Component	Nucleolus	IDA	17558397, 28007894
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	23858059, 28007894
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	NAS	25897075
GO:0005829	Component	Cytosol	TAS
GO:0006281	Process	DNA repair	IEA
GO:0006974	Process	DNA damage response	IDA	17873522
GO:0006974	Process	DNA damage response	IEA
GO:0007062	Process	Sister chromatid cohesion	IMP	15917200
GO:0007346	Process	Regulation of mitotic cell cycle	IDA	19160488
GO:0010629	Process	Negative regulation of gene expression	IGI	23823476
GO:0010629	Process	Negative regulation of gene expression	IMP	23823476
GO:0010868	Process	Negative regulation of triglyceride biosynthetic process	ISS
GO:0010883	Process	Regulation of lipid storage	ISS
GO:0010992	Process	Ubiquitin recycling	IBA
GO:0016567	Process	Protein ubiquitination	IDA	12354302
GO:0016567	Process	Protein ubiquitination	IDA	15103331
GO:0016567	Process	Protein ubiquitination	IEA
GO:0019005	Component	SCF ubiquitin ligase complex	IDA	12628165, 15103331, 17434132, 28007894
GO:0030332	Function	Cyclin binding	IDA	12628165
GO:0030332	Function	Cyclin binding	IPI	17434132
GO:0030674	Function	Protein-macromolecule adaptor activity	IDA	12628165
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IDA	15103331, 17434132
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IEA
GO:0031146	Process	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process	IMP	28007894
GO:0031398	Process	Positive regulation of protein ubiquitination	IDA	12628165
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	12628165
GO:0031647	Process	Regulation of protein stability	IEA
GO:0032435	Process	Negative regulation of proteasomal ubiquitin-dependent protein catabolic process	IDA	34102342
GO:0032880	Process	Regulation of protein localization	ISS
GO:0032991	Component	Protein-containing complex	IDA	17873522
GO:0034644	Process	Cellular response to UV	IDA	17873522
GO:0042752	Process	Regulation of circadian rhythm	IEA
GO:0042752	Process	Regulation of circadian rhythm	IMP	27238018
GO:0042802	Function	Identical protein binding	IPI	21620836, 23791182, 35512704
GO:0043130	Function	Ubiquitin binding	IBA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	20389280
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IDA	15103331
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IMP	25897075, 35395208
GO:0045742	Process	Positive regulation of epidermal growth factor receptor signaling pathway	ISS
GO:0045746	Process	Negative regulation of Notch signaling pathway	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	19160488
GO:0048511	Process	Rhythmic process	IEA
GO:0050816	Function	Phosphothreonine residue binding	IDA	17434132
GO:0050821	Process	Protein stabilization	ISS
GO:0055088	Process	Lipid homeostasis	ISS
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	ISS
GO:0097027	Function	Ubiquitin-protein transferase activator activity	IDA	12628165
GO:1901524	Process	Regulation of mitophagy	IMP	24912190
GO:1901800	Process	Positive regulation of proteasomal protein catabolic process	IDA	23858059
GO:1901800	Process	Positive regulation of proteasomal protein catabolic process	IEA
GO:1902806	Process	Regulation of cell cycle G1/S phase transition	TAS	12628165
GO:1903378	Process	Positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway	IDA	23858059
GO:1903378	Process	Positive regulation of oxidative stress-induced neuron intrinsic apoptotic signaling pathway	IEA
GO:1903955	Process	Positive regulation of protein targeting to mitochondrion	IMP	24912190
GO:1990452	Component	Parkin-FBXW7-Cul1 ubiquitin ligase complex	IPI	12628165
GO:1990756	Function	Ubiquitin-like ligase-substrate adaptor activity	IDA	15150404, 34741373
GO:2000059	Process	Negative regulation of ubiquitin-dependent protein catabolic process	IDA	24424410
GO:2000060	Process	Positive regulation of ubiquitin-dependent protein catabolic process	IEA
GO:2000060	Process	Positive regulation of ubiquitin-dependent protein catabolic process	IMP	27238018
GO:2000060	Process	Positive regulation of ubiquitin-dependent protein catabolic process	ISS
GO:2000346	Process	Negative regulation of hepatocyte proliferation	ISS
GO:2000639	Process	Negative regulation of SREBP signaling pathway	ISS
GO:2001205	Process	Negative regulation of osteoclast development	IEA
GO:2001205	Process	Negative regulation of osteoclast development	IMP	29149593

Other IDs

• MIM: 606278
• HGNC: 16712
• e!Ensembl: ENSG00000109670

Protein

• UniProt ID: Q969H0
• Protein name: F-box/WD repeat-containing protein 7 (Archipelago homolog) (hAgo) (F-box and WD-40 domain-containing protein 7) (F-box protein FBX30) (SEL-10) (hCdc4)
• Protein function: Substrate recognition component of a SCF (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins (PubMed:17434132, PubMed:22748924, PubMed:26976582
• PDB: 2OVP, 2OVQ, 2OVR, 5IBK, 5V4B, 7T1Y, 7T1Z
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF12937	F-box-like	281 → 327	F-box-like	Domain
  PF00400	WD40	370 → 407	WD domain, G-beta repeat	Repeat
  PF00400	WD40	411 → 447	WD domain, G-beta repeat	Repeat
  PF00400	WD40	451 → 487	WD domain, G-beta repeat	Repeat
  PF00400	WD40	491 → 527	WD domain, G-beta repeat	Repeat
  PF00400	WD40	531 → 567	WD domain, G-beta repeat	Repeat
  PF00400	WD40	571 → 607	WD domain, G-beta repeat	Repeat
  PF00400	WD40	611 → 650	WD domain, G-beta repeat	Repeat

• Tissue specificity: TISSUE SPECIFICITY: [Isoform 1]: Widely expressed. {ECO:0000269|PubMed:12354302}.; TISSUE SPECIFICITY: [Isoform 3]: Expressed in brain. {ECO:0000269|PubMed:12354302}.
• Sequence:

  MNQELLSVGSKRRRTGGSLRGNPSSSQVDEEQMNRVVEEEQQQQLRQQEEEHTARNGEVV
  GVEPRPGGQNDSQQGQLEENNNRFISVDEDSSGNQEEQEEDEEHAGEQDEEDEEEEEMDQ
  ESDDFDQSDDSSREDEHTHTNSVTNSSSIVDLPVHQLSSPFYTKTTKMKRKLDHGSEVRS
  FSLGKKPCKVSEYTSTTGLVPCSATPTTFGDLRAANGQGQQRRRITSVQPPTGLQEWLKM
  FQSWSGPEKLLALDELIDSCEPTQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKD
  LLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHR
  IDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGH
  TGGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRD
  ATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGH
  TNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNAD
  STVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNL
  VTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDMK

• Sequence length: 707

Pathways

KEGG:

Ubiquitin mediated proteolysis

Reactome:

Constitutive Signaling by NOTCH1 PEST Domain Mutants
Loss of Function of FBXW7 in Cancer and NOTCH1 Signaling
Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants
Neddylation
Antigen processing: Ubiquitination & Proteasome degradation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Alveolar rhabdomyosarcoma	Likely pathogenic	rs149680468	RCV006253762	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Colorectal cancer	Pathogenic	rs867384286, rs1737970426	RCV006254006 RCV001293827	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Developmental delay, hypotonia, and impaired language	Pathogenic; Likely pathogenic	rs2126479012, rs2126515961, rs2126459625, rs2126497313, rs140856583, rs2126459661, rs2530191471, rs2530775982, rs2530234915, rs2530127005	RCV002279905 RCV002279906 RCV002279907 RCV002279908 RCV002279909 RCV003333630 RCV003387671 RCV003991790 RCV004555085 RCV004595315	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Diffuse pediatric-type high-grade glioma, H3-wildtype and IDH-wildtype	Likely pathogenic	rs149680468	RCV006253764	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
EBV-positive nodal T- and NK-cell lymphoma	Pathogenic	rs2126584285	RCV004560273	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Embryonal rhabdomyosarcoma	Likely pathogenic; Pathogenic	rs2126459661, rs149680468	RCV006254376 RCV006253763	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
FBXW7-related disorder	Pathogenic; Likely pathogenic	rs2126475180, rs2126476768, rs2530218156	RCV003335869 RCV004550799 RCV004548979	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
FBXW7-related neurodevelopmental disorder	Likely pathogenic	rs149680468	RCV003335089	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Medulloblastoma non-WNT/non-SHH group 3	Likely pathogenic	rs149680468	RCV006253766	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Medulloblastoma WNT activated	Pathogenic; Likely pathogenic	rs2126525665, rs2126583593, rs149680468	RCV006254323 RCV006254327 RCV006253765	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neoplasm	Pathogenic	rs867384286	RCV006273730	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neurodevelopmental disorder	Likely pathogenic	rs2126466009, rs2126583593, rs2126464225	RCV002272848 RCV002277696 RCV002277702	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Pervasive developmental disorder	Likely pathogenic	rs2126497313	RCV002282709	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, ADENOID CYSTIC	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, BASAL CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Conflicting classifications of pathogenicity; -	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEVELOPMENTAL DELAY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL SQUAMOUS CELL CARCINOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Medulloblastoma non-WNT/non-SHH	-	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nephroblastoma	-	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SPECIFIC SYNDROMIC INTELLECTUAL DISABILITY	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Predisposition to Wilm's tumor, FBXW7-related	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell lung carcinoma	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	18485478, 19794083, 27229929		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	14507635, 22473991, 25269767, 29219616, 30642944		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	14507635		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	28424412		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	CGI_DG			★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	24360397, 26575021, 29633504, 31534970		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	CTD_human_DG	23685749		★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	21282377		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	31336886		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	20638938, 21282377		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	27229929		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	27625374		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	27247421, 28498285		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	30298802		★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	26354767	Associate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	24899509, 29416754, 30205390		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	17646409, 27602765	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	30275535		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	26377837		★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	27486687		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	28903484		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11565034, 12100739, 14871801, 15318934, 17588203, 18787170, 19587092, 21122106, 21134077, 21368833, 24344117, 25622249, 25721604, 27022068, 27062369, 27409838, 28007894, 28149200, 29534580, 30365154, 30622242, 30830867, 31337255, 31351478		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	17588203		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	15318934, 21122106, 21134077, 22538770, 25669969, 25927147, 26482194, 27409838, 30365154, 31351478, 31704974, 34181803, 34953047, 35132755, 35508987	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	23166673, 37902422	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cap Myopathy	Cap myopathy	Pubtator	29453410	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	15150404, 16357515, 20388706, 20448329, 22608923, 25860929, 27232758, 27998038, 28760857, 28980868, 29735700, 29963728, 35225231	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	16863506, 35840806	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	16824748, 20448329, 22473991, 22923510, 27409838		★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	26647729	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24586741, 26602384, 28716020, 39473409	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma in situ of endometrium	Endometrial carcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Carcinoma Large Cell	Large cell carcinoma	Pubtator	26317919	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	23954152, 26981779, 30689667, 34593967, 35336880	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28581525, 28949784, 29324317, 29633504, 31202256		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	27486687, 37247277	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	27144525, 28718916, 35231161	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	29097832	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	25512615	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	24390348, 26030731, 26479420, 28099906, 28177435, 28581676, 29980281, 33197299, 34851968, 36225179, 36869079	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	CTD_human_DG	26950094		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	26647729		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	15913747, 26109557, 26588236, 26740259, 29267856, 30216591, 30304728, 30466805, 30979843		★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinoma	Pubtator	28940304, 30194005, 32114514	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	25623537, 30197537		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	22473991		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	25623537, 30197537		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	20861909, 27229929		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	27625374		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	25536104, 27593557, 30302867	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	25749036, 27593557, 28184929, 28521468, 30302867, 31195063		★☆☆☆☆ Found in Text Mining only
Chromosomal Instability	Chromosomal instability	Pubtator	17457043, 18299561, 28760857, 28980868	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	22150006, 30510140		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	29550488, 31246581		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	23558291, 29910683		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	28424412, 31876604	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	14999283, 16357143, 19739118, 20638938, 22473991, 23676439, 25450649, 25855785, 25860929, 26097998, 27244218, 27399335, 27423313, 28424412, 28699179, 29346117, 29550488, 29628506, 29701752, 29910683, 30783098, 30981757, 31064356, 31067777, 31519156, 31569395		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	14999283		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	14999283, 17457043, 22285861, 23558291, 24475022, 24586741, 25450649, 25617745, 25855785, 25860929, 26097998, 26134512, 26375816, 26797410, 27146902, 27155048, 27221540, 27244218, 27470268, 28424412, 29307989, 29701752, 29735700, 29945573, 31127692, 31255173, 31450901, 31519156, 31548566, 31876604, 32166754, 33013820, 33714943, 33854094, 34111531, 35225231, 35459861, 36202073, 36520636, 36934104, 37097008, 37158960, 37164664, 37189003, 37202390, 39329268, 39333321	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	16357143		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	29910683	Inhibit	★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	25536104, 25749036, 28184929		★☆☆☆☆ Found in Text Mining only
Congenital Disorder Of Glycosylation Type Im	Congenital disorder of glycosylation	Pubtator	29290541	Associate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	26163148, 29097832, 29456733		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	29152152		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	29152152		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	29152152		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	28949784		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	28949784	Associate	★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	31738757		★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	35395208	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	23418607		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	23418607		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	34372947	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	34372947	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	29475832		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	30054458, 30718926		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	31119177	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	31119177		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	31415795		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	28069035		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	36570009	Associate	★☆☆☆☆ Found in Text Mining only
Dysplastic Nevus	Dysplastic Nevus	BEFREE	23381582		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	12183400, 14648662, 15048079, 15913747, 29963728, 30910254, 31772025		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	CTD_human_DG	23104009		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	CTD_human_DG	23104009		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	23104009, 29963728, 32239181, 32248654, 33536036, 33754208, 33872388, 36454788, 37587857, 38536067	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ependymoma	Ependymoma	BEFREE	25486598		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	29267856, 30304728		★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	16061623		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	22576686, 30098297		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	22108521, 27107065, 29127303, 30115035	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	22576686, 30098297		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	22108521, 26857264, 26873401, 27259248, 27734031, 36991467	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fanconi Anemia	Fanconi anemia	Pubtator	30789902	Associate	★☆☆☆☆ Found in Text Mining only
Fibrocystic Breast Disease	Breast fibrocystic disease	Pubtator	33382535	Associate	★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	26482194		★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	28464881		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	BEFREE	30881487		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	30854619		★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	28000896		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	16204036, 28903484, 29427543		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	29427543, 34278448	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	33247464	Inhibit	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	16204036, 28903484, 29427543		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	17274947, 18931460		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	CTD_human_DG	18931460		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	Pubtator	18931460, 29427543, 31740732	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	BEFREE	28903484, 29427543, 31258712		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma	Glioma	Pubtator	31519156, 32365279, 33247464	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glomerulosclerosis Focal Segmental	Focal segmental glomerulosclerosis	Pubtator	26482194	Associate	★☆☆☆☆ Found in Text Mining only
GLOMUVENOUS MALFORMATIONS	Glomuvenous Malformation	BEFREE	22405651		★☆☆☆☆ Found in Text Mining only
Hajdu-Cheney Syndrome	Hajdu-Cheney Syndrome	BEFREE	29149593		★☆☆☆☆ Found in Text Mining only
Hamartoma	Hamartoma	BEFREE	21123947		★☆☆☆☆ Found in Text Mining only
Hemangioma capillary infantile	Capillary infantile hemangioma	Pubtator	36181115	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	36322817	Associate	★☆☆☆☆ Found in Text Mining only
Hemorrhagic Disorders	Hemorrhagic Disorders	BEFREE	30902107		★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	35507738	Associate	★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular degeneration	Pubtator	35395208	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	16357515	Associate	★☆☆☆☆ Found in Text Mining only
Hermanski-Pudlak Syndrome	Hermansky-Pudlak Syndrome	BEFREE	19497727		★☆☆☆☆ Found in Text Mining only
Hermaphroditism	Hermaphroditism	BEFREE	15306688		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	26482194	Associate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	15474170		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	17646408	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	29475832		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	21964756, 26467103	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	36240645	Stimulate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	29550488, 31246581		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	32697969	Associate	★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	35395208	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Cancer	Intestinal Cancer	BEFREE	22473991		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	32198650	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	20638938, 21282377		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	31195063		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	17909182		★☆☆☆☆ Found in Text Mining only
Keratitis	Keratitis	BEFREE	17418418		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	23166673, 29097832	Inhibit	★☆☆☆☆ Found in Text Mining only
Laryngitis	Laryngitis	Pubtator	29700339	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	17646408, 17646409, 18451101, 23791182, 28149836		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	17646408, 17646409	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	31638252	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	23359299		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	17646408, 27247421		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	LHGDN	17646408		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	29037125		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	23258480, 23840897, 24686546, 24731221, 24884509, 25445601, 25622249, 25955618, 26323375, 26602384, 27704356, 28716020, 30535501, 31612394		★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	24586741	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	23108047, 28949784	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	29633504		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	19421223, 30275535		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24053468	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	18485478, 19794083		★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	LHGDN	18485478		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	15150404	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	16357143, 17515920, 26575021, 27300436		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	31655559	Associate	★☆☆☆☆ Found in Text Mining only
Machado-Joseph Disease	Machado-Joseph Disease	BEFREE	30856185		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	CTD_human_DG	18931460		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	28903484		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11565034, 12100739, 15318934, 17588203, 18787170, 19587092, 21122106, 21134077, 21368833, 24344117, 25622249, 25721604, 27022068, 27062369, 27409838, 28007894, 28149200, 29534580, 30365154, 30622242, 30830867, 31337255, 31351478		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	17588203		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	12183400, 15048079, 29963728, 31772025		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	CGI_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	22576686, 30098297		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	19963109, 23166673, 26163148, 29097832		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28581525, 28949784, 29324317, 29633504, 31202256		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	29037125		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	15913747, 26109557, 26588236, 26740259, 30216591, 30466805, 30979843		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	14507635, 24899509, 25638153, 25753158, 26983463, 27485116, 28242758, 28765935, 29348852, 30922330		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	16357515, 17274947, 23166673		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	31843895		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	16824748, 19366810, 20448329, 22270966, 24053468, 25159729, 25944166, 26499948, 29701752, 29720189, 30006025, 30177679		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	30226614		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	23166673		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	14871801, 15118416, 16210249, 16357143, 16357515, 16863506, 17909001, 18541364, 21282377, 21368833, 21503901, 21597324, 22006825, 22576686, 22673505, 23166673, 23518350, 23558291, 24165483, 24220575, 24265759, 24899581, 25314076, 25361747, 25555218, 25622249, 25749036, 25860929, 26354767, 26377837, 26410034, 26459133, 26482194, 26560120, 26954701, 26983463, 27232758, 27486687, 27518285, 27625374, 28000899, 28007894, 28209614, 28522751, 28699179, 28760857, 28949784, 28963353, 29072128, 29097832, 29150959, 29348852, 29355657, 29408378, 29427543, 29474981, 29665239, 29735700, 29796163, 30001747, 30086763, 30094882, 30275535, 30606768, 30722038, 30783083, 30791487, 30881487, 31372648, 31519156		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	25623537, 30197537		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	23558291, 29910683		★☆☆☆☆ Found in Text Mining only
Malignant Uterine Corpus Neoplasm	Malignant Uterine Corpus Neoplasm	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	17588203		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	17588203		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	17588203		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	18787170		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	17588203		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	27625374		★☆☆☆☆ Found in Text Mining only
Melanocytic nevus syndrome congenital	Melanocytic nevus	Pubtator	34912899	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	23381582, 24838835, 29665239, 31843895		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	23381582, 24838835, 29665239	Inhibit	★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	25784655, 31843895, 39213172	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	28949784		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	16829781		★☆☆☆☆ Found in Text Mining only
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	30689667		★☆☆☆☆ Found in Text Mining only
Mesangial sclerosis diffuse	Diffuse mesangial sclerosis	Pubtator	31119177	Associate	★☆☆☆☆ Found in Text Mining only
mixed gliomas	Glioma	CTD_human_DG	18931460		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	29037125	Associate	★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Facioscapulohumeral	Facioscapulohumeral Muscular Dystrophy	BEFREE	26041815		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	23518350		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	25586348		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	25586348, 28581676	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12183400, 14648662, 14871801, 16061623, 16824748, 16837775, 16863506, 16938571, 17274947, 17575125, 17588203, 17646408, 17909001, 18451101, 18485478, 18541364, 18787170, 18938137, 19366810, 19739118, 19963109, 20332316, 20448329, 20484041, 20638938, 20815813, 21122106, 21134077, 21282377, 21368833, 21597324, 21608150, 21642990, 22006825, 22513362, 22538770, 22576686, 22673505, 22708077, 22923510, 23166673, 23381582, 23575666, 23670162, 23676439, 23840897, 23857984, 24030976, 24053468, 24165483, 24220575, 24344117, 24377525, 24586741, 24686546, 24727676, 24731221, 24838835, 24884509, 24899509, 24899581, 25269767, 25314076, 25361747, 25450649, 25586348, 25622249, 25749036, 25753158, 25860929, 25955618, 26097998, 26163148, 26323375, 26354767, 26410034, 26459133, 26482194, 26560120, 26575021, 26602384, 26774286, 26983463, 27167197, 27247421, 27269942, 27300436, 27350307, 27399335, 27485116, 27486687, 27764699, 28069035, 28177435, 28242758, 28422719, 28442573, 28464881, 28521468, 28734796, 28760857, 28765935, 28846828, 28850619, 29097832, 29346117, 29355657, 29416754, 29474981, 29496961, 29534580, 29633504, 29638162, 29665239, 29689640, 29735700, 29910683, 29963728, 30086763, 30094882, 30177679, 30197537, 30275535, 30302867, 30466805, 30606768, 30642944, 30689667, 30722038, 30742097, 30783098, 30854619, 30865892, 30922330, 30953189, 31152129, 31195063, 31281471, 31289136, 31351478, 31519156, 31534970, 31569395		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	20332316		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	25271087		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	30851333		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	26479420		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	31215394		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	24165483, 26464659, 28000899, 28522751, 28656290, 28949784, 29355657, 29633504, 29701752, 29736206, 30094882, 31202256		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	21123947		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	36291149	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	32572904	Associate	★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	28685750		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	30809532	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis, Postmenopausal	Osteoporosis	BEFREE	30809532		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	16938571, 25622249, 28979804		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	LHGDN	16938571		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	15913747, 26109557, 26588236, 26740259, 27486687, 30216591, 30466805, 30979843		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	17320938		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	23774303, 24586741, 28734796, 29793804, 35965327, 36982928, 37247277	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	27486687	Inhibit	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	14507635, 24899509, 25638153, 25753158, 26983463, 27485116, 28242758, 28765935, 29348852, 30922330		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	25753158		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	14507635		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	25638153, 28099906, 28242758, 28765935, 33271455	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	34117747	Inhibit	★☆☆☆☆ Found in Text Mining only
Papillary renal cell carcinoma, sporadic	Papillary renal carcinoma	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	15474170		★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	27764699		★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	32166754	Associate	★☆☆☆☆ Found in Text Mining only
Polyarteritis Nodosa	Polyarteritis Nodosa	BEFREE	24220575		★☆☆☆☆ Found in Text Mining only
POLYARTERITIS NODOSA, CHILDHOOD-ONSET	Polyarteritis Nodosa	BEFREE	24220575		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	19794083, 26644537, 30742097		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	17515920, 17575125, 17646408, 17646409, 17934490, 18485478, 19245433, 19340001, 19635999, 20861909, 20861920, 21263446, 21368833, 21608150, 21642990, 23228967, 23857984, 24424791, 24727676, 24740809, 25231743, 25355291, 25493453, 26220040, 26341754, 27602765, 29029518, 29200162, 30387229		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	CTD_human_DG	19246562, 24394663		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	CGI_DG			★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	16357515		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	16357515, 23166673	Associate	★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	26163148, 29097832		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	19963109, 26163148, 29097832, 29456733		★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor	Rhabdoid tumor	Pubtator	30885698	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	31748650		★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	28424412		★☆☆☆☆ Found in Text Mining only
Serous cystadenocarcinoma ovary	Ovarian Serous Cystadenocarcinoma	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	23274910, 26030731, 26954701, 27300436, 29072128, 29633504, 31161818		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	22576686, 27259248, 29048664, 30098297		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	CTD_human_DG	25151357		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	21798897, 24586741, 27323410, 29053175, 32329846, 32892208, 36522371	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	29072128, 30883339	Inhibit	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	30642944		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	27323410, 31281471		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	27350307		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of vulva	Carcinoma Of Vulva	BEFREE	29422544		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	21123947		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	16824748, 19366810, 20448329, 22270966, 24053468, 25159729, 25944166, 26499948, 29701752, 29720189, 30006025		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	20448329, 24053468, 25888377, 26499948, 26857264, 27167197, 28464881, 28522256, 30177679, 35280682	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	24053468		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	19245433		★☆☆☆☆ Found in Text Mining only
Teratoma	Teratoma	BEFREE	23507969		★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular Germ Cell Tumor	BEFREE	28000896		★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	28000896	Associate	★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	18938137		★☆☆☆☆ Found in Text Mining only
Thyroid cancer follicular	Follicular thyroid cancer	Pubtator	31248021	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	30226614		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	30226614		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	32737449	Associate	★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	22538770	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	28036276, 31536884		★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	BEFREE	24451280		★☆☆☆☆ Found in Text Mining only
Uranostaphyloschisis	Uranostaphyloschisis	BEFREE	29386660		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	23166673	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Carcinosarcoma	Endometrial Cancer	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Uterine Carcinosarcoma	Endometrial Cancer	BEFREE	31772025		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasm	Uterine cervix neoplasm	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	24390348, 26155992, 32951893	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	35094292	Inhibit	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	25361747		★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	20332316, 26482194, 30885698, 37019617	Associate	★☆☆☆☆ Found in Text Mining only