BRF2 (BRF2 general transcription factor IIIB subunit)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 55290
• Gene name: BRF2 general transcription factor IIIB subunit
• Gene symbol: BRF2
• Synonyms (NCBI Gene): BRFU, TFIIIB50
• Chromosome: 8
• Chromosome location: 8p11.23
• Summary: This gene encodes one of the multiple subunits of the RNA polymerase III transcription factor complex required for transcription of genes with promoter elements upstream of the initiation site. The product of this gene, a TFIIB-like factor, is directly re

miRNA Show/Hide all (125)

miRTarBase ID	miRNA	Experiments	Reference
MIRT441104	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT441104	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT824633	hsa-miR-150	CLIP-seq
MIRT824634	hsa-miR-188-3p	CLIP-seq
MIRT824635	hsa-miR-3177-5p	CLIP-seq
MIRT824636	hsa-miR-4307	CLIP-seq
MIRT824637	hsa-miR-4515	CLIP-seq
MIRT824638	hsa-miR-4646-5p	CLIP-seq
MIRT824639	hsa-miR-4713-5p	CLIP-seq
MIRT824640	hsa-miR-4731-5p	CLIP-seq
MIRT824641	hsa-miR-4788	CLIP-seq
MIRT824642	hsa-miR-532-3p	CLIP-seq
MIRT824643	hsa-miR-891b	CLIP-seq
MIRT1943782	hsa-miR-1276	CLIP-seq
MIRT1943783	hsa-miR-15a	CLIP-seq
MIRT1943784	hsa-miR-15b	CLIP-seq
MIRT1943785	hsa-miR-16	CLIP-seq
MIRT1943786	hsa-miR-195	CLIP-seq
MIRT1943787	hsa-miR-424	CLIP-seq
MIRT1943788	hsa-miR-4293	CLIP-seq
MIRT1943789	hsa-miR-4530	CLIP-seq
MIRT1943790	hsa-miR-497	CLIP-seq
MIRT1943791	hsa-miR-545	CLIP-seq
MIRT1943792	hsa-miR-634	CLIP-seq
MIRT2182488	hsa-let-7a	CLIP-seq
MIRT2182489	hsa-let-7b	CLIP-seq
MIRT2182490	hsa-let-7c	CLIP-seq
MIRT2182491	hsa-let-7d	CLIP-seq
MIRT2182492	hsa-let-7e	CLIP-seq
MIRT2182493	hsa-let-7f	CLIP-seq
MIRT2182494	hsa-let-7g	CLIP-seq
MIRT2182495	hsa-let-7i	CLIP-seq
MIRT2182496	hsa-miR-1225-3p	CLIP-seq
MIRT1943782	hsa-miR-1276	CLIP-seq
MIRT1943783	hsa-miR-15a	CLIP-seq
MIRT1943784	hsa-miR-15b	CLIP-seq
MIRT1943785	hsa-miR-16	CLIP-seq
MIRT1943786	hsa-miR-195	CLIP-seq
MIRT2182497	hsa-miR-202	CLIP-seq
MIRT2182498	hsa-miR-3125	CLIP-seq
MIRT2182499	hsa-miR-3129-3p	CLIP-seq
MIRT2182500	hsa-miR-3916	CLIP-seq
MIRT2182501	hsa-miR-3927	CLIP-seq
MIRT1943787	hsa-miR-424	CLIP-seq
MIRT2182502	hsa-miR-425	CLIP-seq
MIRT1943788	hsa-miR-4293	CLIP-seq
MIRT2182503	hsa-miR-4446-5p	CLIP-seq
MIRT2182504	hsa-miR-4451	CLIP-seq
MIRT2182505	hsa-miR-4458	CLIP-seq
MIRT2182506	hsa-miR-4500	CLIP-seq
MIRT1943789	hsa-miR-4530	CLIP-seq
MIRT2182507	hsa-miR-4695-3p	CLIP-seq
MIRT2182508	hsa-miR-4749-3p	CLIP-seq
MIRT1943790	hsa-miR-497	CLIP-seq
MIRT1943791	hsa-miR-545	CLIP-seq
MIRT1943792	hsa-miR-634	CLIP-seq
MIRT2182509	hsa-miR-877	CLIP-seq
MIRT2182510	hsa-miR-98	CLIP-seq
MIRT2486150	hsa-miR-1257	CLIP-seq
MIRT2486151	hsa-miR-1273d	CLIP-seq
MIRT2486152	hsa-miR-1296	CLIP-seq
MIRT824633	hsa-miR-150	CLIP-seq
MIRT824634	hsa-miR-188-3p	CLIP-seq
MIRT2486153	hsa-miR-216b	CLIP-seq
MIRT2486154	hsa-miR-2355-5p	CLIP-seq
MIRT2486155	hsa-miR-296-3p	CLIP-seq
MIRT2486156	hsa-miR-3145-5p	CLIP-seq
MIRT2486157	hsa-miR-329	CLIP-seq
MIRT2486158	hsa-miR-342-3p	CLIP-seq
MIRT2486159	hsa-miR-362-3p	CLIP-seq
MIRT2486160	hsa-miR-3915	CLIP-seq
MIRT2486161	hsa-miR-3921	CLIP-seq
MIRT2486162	hsa-miR-3928	CLIP-seq
MIRT2486163	hsa-miR-3941	CLIP-seq
MIRT2486164	hsa-miR-4268	CLIP-seq
MIRT2486165	hsa-miR-4317	CLIP-seq
MIRT2182503	hsa-miR-4446-5p	CLIP-seq
MIRT2486166	hsa-miR-4512	CLIP-seq
MIRT2486167	hsa-miR-4640-5p	CLIP-seq
MIRT2486168	hsa-miR-4649-3p	CLIP-seq
MIRT2486169	hsa-miR-4653-5p	CLIP-seq
MIRT824639	hsa-miR-4713-5p	CLIP-seq
MIRT2486170	hsa-miR-4726-5p	CLIP-seq
MIRT824640	hsa-miR-4731-5p	CLIP-seq
MIRT2486171	hsa-miR-4793-3p	CLIP-seq
MIRT2486172	hsa-miR-4802-3p	CLIP-seq
MIRT2486173	hsa-miR-483-3p	CLIP-seq
MIRT2486174	hsa-miR-508-5p	CLIP-seq
MIRT824642	hsa-miR-532-3p	CLIP-seq
MIRT2486175	hsa-miR-603	CLIP-seq
MIRT2486176	hsa-miR-665	CLIP-seq
MIRT2486177	hsa-miR-711	CLIP-seq
MIRT824643	hsa-miR-891b	CLIP-seq
MIRT2486150	hsa-miR-1257	CLIP-seq
MIRT2486151	hsa-miR-1273d	CLIP-seq
MIRT2486152	hsa-miR-1296	CLIP-seq
MIRT824633	hsa-miR-150	CLIP-seq
MIRT824634	hsa-miR-188-3p	CLIP-seq
MIRT2486153	hsa-miR-216b	CLIP-seq
MIRT2486154	hsa-miR-2355-5p	CLIP-seq
MIRT2486155	hsa-miR-296-3p	CLIP-seq
MIRT2486157	hsa-miR-329	CLIP-seq
MIRT2486158	hsa-miR-342-3p	CLIP-seq
MIRT2486159	hsa-miR-362-3p	CLIP-seq
MIRT2486160	hsa-miR-3915	CLIP-seq
MIRT2486161	hsa-miR-3921	CLIP-seq
MIRT2486162	hsa-miR-3928	CLIP-seq
MIRT2486163	hsa-miR-3941	CLIP-seq
MIRT2486164	hsa-miR-4268	CLIP-seq
MIRT2486165	hsa-miR-4317	CLIP-seq
MIRT2182503	hsa-miR-4446-5p	CLIP-seq
MIRT2486166	hsa-miR-4512	CLIP-seq
MIRT2486167	hsa-miR-4640-5p	CLIP-seq
MIRT824638	hsa-miR-4646-5p	CLIP-seq
MIRT2486168	hsa-miR-4649-3p	CLIP-seq
MIRT2486169	hsa-miR-4653-5p	CLIP-seq
MIRT824639	hsa-miR-4713-5p	CLIP-seq
MIRT2486170	hsa-miR-4726-5p	CLIP-seq
MIRT824640	hsa-miR-4731-5p	CLIP-seq
MIRT2486171	hsa-miR-4793-3p	CLIP-seq
MIRT2486172	hsa-miR-4802-3p	CLIP-seq
MIRT2486173	hsa-miR-483-3p	CLIP-seq
MIRT824642	hsa-miR-532-3p	CLIP-seq
MIRT2486175	hsa-miR-603	CLIP-seq
MIRT824643	hsa-miR-891b	CLIP-seq

Gene ontology (GO) Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000126	Component	Transcription factor TFIIIB complex	IMP	26638071
GO:0001006	Function	RNA polymerase III type 3 promoter sequence-specific DNA binding	IDA	26638071
GO:0005515	Function	Protein binding	IPI	28514442, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006352	Process	DNA-templated transcription initiation	IEA
GO:0006359	Process	Regulation of transcription by RNA polymerase III	IMP	26638071
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0016251	Function	RNA polymerase II general transcription initiation factor activity	IBA
GO:0017025	Function	TBP-class protein binding	IBA
GO:0034599	Process	Cellular response to oxidative stress	IMP	26638071
GO:0046872	Function	Metal ion binding	IEA
GO:0070897	Process	Transcription preinitiation complex assembly	IEA
GO:0097550	Component	Transcription preinitiation complex	IBA

Other IDs

• MIM: 607013
• HGNC: 17298
• e!Ensembl: ENSG00000104221

Protein

• UniProt ID: Q9HAW0
• Protein name: Transcription factor IIIB 50 kDa subunit (TFIIIB50) (hTFIIIB50) (B-related factor 2) (BRF-2) (hBRFU)
• Protein function: General activator of RNA polymerase III transcription. Factor exclusively required for RNA polymerase III transcription of genes with promoter elements upstream of the initiation sites (PubMed:11040218, PubMed:11121026, PubMed:11564744, PubMed:2
• PDB: 4ROC , 4ROD , 4ROE , 5N9G , 8ITY , 8IUE , 8IUH , 9FSO , 9FSP , 9FSQ , 9FSR , 9FSS
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF08271	TF_Zn_Ribbon	5 → 42	TFIIB zinc-binding	Domain

• Sequence:

  MPGRGRCPDCGSTELVEDSHYSQSQLVCSDCGCVVTEGVLTTTFSDEGNLREVTYSRSTG
  ENEQVSRSQQRGLRRVRDLCRVLQLPPTFEDTAVAYYQQAYRHSGIRAARLQKKEVLVGC
  CVLITCRQHNWPLTMGAICTLLYADLDVFSSTYMQIVKLLGLDVPSLCLAELVKTYCSSF
  KLFQASPSVPAKYVEDKEKMLSRTMQLVELANETWLVTGRHPLPVITAATFLAWQSLQPA
  DRLSCSLARFCKLANVDLPYPASSRLQELLAVLLRMAEQLAWLRVLRLDKRSVVKHIGDL
  LQHRQSLVRSAFRDGTAEVETREKEPPGWGQGQGEGEVGNNSLGLPQGKRPASPALLLPP
  CMLKSPKRICPVPPVSTVTGDENISDSEIEQYLRTPQEVRDFQRAQAARQAATSVPNPP

• Sequence length: 419

Pathways

Reactome Pathway:

RNA Polymerase III Transcription Initiation From Type 3 Promoter

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
BRF2-related disorder	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (15)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Carcinoma	Breast Carcinoma	BEFREE	26573593, 26805938		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25994018	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	20668658	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	30618167		★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	20668658	Stimulate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	32705258	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25994018, 26573593, 26805938		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	26573593, 30618167		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	18700021, 20668658, 21518452, 23550276, 26573593		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	24523874, 24738062		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	24523874, 24736592, 24738062, 29025258		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	20668658, 21518452, 30182305		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	23550276, 30182305		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	20668658		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	17624304	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

No strongly related genes found yet for BRF2.

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to BRF2.