Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	55279
Gene name	Zinc finger protein 654
Gene symbol	ZNF654
Synonyms (NCBI Gene)	-
Chromosome	3
Chromosome location	3p11.1

172

Show/Hide all (172)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016826	hsa-miR-335-5p	Microarray	18185580
MIRT697294	hsa-miR-3133	HITS-CLIP	23313552
MIRT697295	hsa-miR-186-5p	HITS-CLIP	23313552
MIRT697293	hsa-miR-153-5p	HITS-CLIP	23313552
MIRT697292	hsa-miR-6759-3p	HITS-CLIP	23313552
MIRT450637	hsa-miR-203a-3p	PAR-CLIP	22100165
MIRT308546	hsa-miR-101-3p	PAR-CLIP	22100165
MIRT308549	hsa-miR-4282	PAR-CLIP	22100165
MIRT450636	hsa-miR-1252-3p	PAR-CLIP	22100165
MIRT450635	hsa-miR-3606-3p	PAR-CLIP	22100165
MIRT450634	hsa-miR-513a-3p	PAR-CLIP	22100165
MIRT450633	hsa-miR-513c-3p	PAR-CLIP	22100165
MIRT308550	hsa-miR-3613-3p	PAR-CLIP	22100165
MIRT450632	hsa-miR-4635	PAR-CLIP	22100165
MIRT450631	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT450630	hsa-miR-578	PAR-CLIP	22100165
MIRT697294	hsa-miR-3133	HITS-CLIP	23313552
MIRT697295	hsa-miR-186-5p	HITS-CLIP	23313552
MIRT697293	hsa-miR-153-5p	HITS-CLIP	23313552
MIRT697292	hsa-miR-6759-3p	HITS-CLIP	23313552
MIRT450637	hsa-miR-203a-3p	PAR-CLIP	22100165
MIRT308546	hsa-miR-101-3p	PAR-CLIP	22100165
MIRT308549	hsa-miR-4282	PAR-CLIP	22100165
MIRT450636	hsa-miR-1252-3p	PAR-CLIP	22100165
MIRT450635	hsa-miR-3606-3p	PAR-CLIP	22100165
MIRT450634	hsa-miR-513a-3p	PAR-CLIP	22100165
MIRT450633	hsa-miR-513c-3p	PAR-CLIP	22100165
MIRT308550	hsa-miR-3613-3p	PAR-CLIP	22100165
MIRT450632	hsa-miR-4635	PAR-CLIP	22100165
MIRT450631	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT450630	hsa-miR-578	PAR-CLIP	22100165
MIRT1533944	hsa-miR-1182	CLIP-seq
MIRT1533945	hsa-miR-1208	CLIP-seq
MIRT1533946	hsa-miR-1299	CLIP-seq
MIRT1533947	hsa-miR-137	CLIP-seq
MIRT1533948	hsa-miR-141	CLIP-seq
MIRT1533949	hsa-miR-186	CLIP-seq
MIRT1533950	hsa-miR-200a	CLIP-seq
MIRT1533951	hsa-miR-203	CLIP-seq
MIRT1533952	hsa-miR-21	CLIP-seq
MIRT1533953	hsa-miR-24	CLIP-seq
MIRT1533954	hsa-miR-25	CLIP-seq
MIRT1533955	hsa-miR-3117-5p	CLIP-seq
MIRT1533956	hsa-miR-3129-3p	CLIP-seq
MIRT1533957	hsa-miR-3143	CLIP-seq
MIRT1533958	hsa-miR-3148	CLIP-seq
MIRT1533959	hsa-miR-32	CLIP-seq
MIRT1533960	hsa-miR-335	CLIP-seq
MIRT1533961	hsa-miR-363	CLIP-seq
MIRT1533962	hsa-miR-3646	CLIP-seq
MIRT1533963	hsa-miR-367	CLIP-seq
MIRT1533964	hsa-miR-3689a-3p	CLIP-seq
MIRT1533965	hsa-miR-3689c	CLIP-seq
MIRT1533966	hsa-miR-4284	CLIP-seq
MIRT1533967	hsa-miR-4328	CLIP-seq
MIRT1533968	hsa-miR-4420	CLIP-seq
MIRT1533969	hsa-miR-4460	CLIP-seq
MIRT1533970	hsa-miR-4477a	CLIP-seq
MIRT1533971	hsa-miR-4502	CLIP-seq
MIRT1533972	hsa-miR-4686	CLIP-seq
MIRT1533973	hsa-miR-4727-3p	CLIP-seq
MIRT1533974	hsa-miR-4728-5p	CLIP-seq
MIRT1533975	hsa-miR-4735-5p	CLIP-seq
MIRT1533976	hsa-miR-4775	CLIP-seq
MIRT1533977	hsa-miR-4782-5p	CLIP-seq
MIRT1533978	hsa-miR-491-3p	CLIP-seq
MIRT1533979	hsa-miR-499a-5p	CLIP-seq
MIRT1533980	hsa-miR-501-3p	CLIP-seq
MIRT1533981	hsa-miR-502-3p	CLIP-seq
MIRT1533982	hsa-miR-516b	CLIP-seq
MIRT1533983	hsa-miR-526b	CLIP-seq
MIRT1533984	hsa-miR-548u	CLIP-seq
MIRT1533985	hsa-miR-590-5p	CLIP-seq
MIRT1533986	hsa-miR-642b	CLIP-seq
MIRT1533987	hsa-miR-653	CLIP-seq
MIRT1533988	hsa-miR-875-3p	CLIP-seq
MIRT1533989	hsa-miR-922	CLIP-seq
MIRT1533990	hsa-miR-92a	CLIP-seq
MIRT1533991	hsa-miR-92b	CLIP-seq
MIRT1533992	hsa-miR-938	CLIP-seq
MIRT2161521	hsa-miR-1244	CLIP-seq
MIRT2161522	hsa-miR-1302	CLIP-seq
MIRT1533949	hsa-miR-186	CLIP-seq
MIRT2161523	hsa-miR-3122	CLIP-seq
MIRT1533956	hsa-miR-3129-3p	CLIP-seq
MIRT2161524	hsa-miR-3163	CLIP-seq
MIRT2161525	hsa-miR-3606	CLIP-seq
MIRT2161526	hsa-miR-3607-3p	CLIP-seq
MIRT1533964	hsa-miR-3689a-3p	CLIP-seq
MIRT1533965	hsa-miR-3689c	CLIP-seq
MIRT2161527	hsa-miR-3913-5p	CLIP-seq
MIRT2161528	hsa-miR-4298	CLIP-seq
MIRT2161529	hsa-miR-4694-3p	CLIP-seq
MIRT1533975	hsa-miR-4735-5p	CLIP-seq
MIRT2161530	hsa-miR-494	CLIP-seq
MIRT2161531	hsa-miR-514	CLIP-seq
MIRT2161532	hsa-miR-514b-3p	CLIP-seq
MIRT2161533	hsa-miR-520d-5p	CLIP-seq
MIRT2161534	hsa-miR-524-5p	CLIP-seq
MIRT2161535	hsa-miR-590-3p	CLIP-seq
MIRT1533992	hsa-miR-938	CLIP-seq
MIRT2380320	hsa-miR-1246	CLIP-seq
MIRT2380321	hsa-miR-1290	CLIP-seq
MIRT2380322	hsa-miR-129-5p	CLIP-seq
MIRT2380323	hsa-miR-298	CLIP-seq
MIRT2380324	hsa-miR-3074-3p	CLIP-seq
MIRT1533957	hsa-miR-3143	CLIP-seq
MIRT2161524	hsa-miR-3163	CLIP-seq
MIRT2380325	hsa-miR-3167	CLIP-seq
MIRT2380326	hsa-miR-3622b-5p	CLIP-seq
MIRT2380327	hsa-miR-3647-3p	CLIP-seq
MIRT2380328	hsa-miR-3678-3p	CLIP-seq
MIRT1533964	hsa-miR-3689a-3p	CLIP-seq
MIRT1533965	hsa-miR-3689c	CLIP-seq
MIRT2380329	hsa-miR-374a	CLIP-seq
MIRT2380330	hsa-miR-374b	CLIP-seq
MIRT2380331	hsa-miR-3945	CLIP-seq
MIRT2380332	hsa-miR-4253	CLIP-seq
MIRT2380333	hsa-miR-4264	CLIP-seq
MIRT2380334	hsa-miR-4265	CLIP-seq
MIRT2380335	hsa-miR-4296	CLIP-seq
MIRT2380336	hsa-miR-431	CLIP-seq
MIRT2380337	hsa-miR-4322	CLIP-seq
MIRT2380338	hsa-miR-4417	CLIP-seq
MIRT2380339	hsa-miR-4676-5p	CLIP-seq
MIRT2161529	hsa-miR-4694-3p	CLIP-seq
MIRT1533974	hsa-miR-4728-5p	CLIP-seq
MIRT1533976	hsa-miR-4775	CLIP-seq
MIRT2380340	hsa-miR-4797-3p	CLIP-seq
MIRT2380341	hsa-miR-490-5p	CLIP-seq
MIRT2380342	hsa-miR-500a	CLIP-seq
MIRT2380343	hsa-miR-543	CLIP-seq
MIRT2380344	hsa-miR-548a-5p	CLIP-seq
MIRT2380345	hsa-miR-548ab	CLIP-seq
MIRT2380346	hsa-miR-548ak	CLIP-seq
MIRT2380347	hsa-miR-548b-5p	CLIP-seq
MIRT2380348	hsa-miR-548c-5p	CLIP-seq
MIRT2380349	hsa-miR-548d-5p	CLIP-seq
MIRT2380350	hsa-miR-548h	CLIP-seq
MIRT2380351	hsa-miR-548i	CLIP-seq
MIRT2380352	hsa-miR-548j	CLIP-seq
MIRT2380353	hsa-miR-548n	CLIP-seq
MIRT2380354	hsa-miR-548p	CLIP-seq
MIRT2380355	hsa-miR-548t	CLIP-seq
MIRT2380356	hsa-miR-548w	CLIP-seq
MIRT2380357	hsa-miR-548y	CLIP-seq
MIRT2380358	hsa-miR-559	CLIP-seq
MIRT2380359	hsa-miR-570	CLIP-seq
MIRT2380360	hsa-miR-575	CLIP-seq
MIRT2161535	hsa-miR-590-3p	CLIP-seq
MIRT2380361	hsa-miR-622	CLIP-seq
MIRT1533986	hsa-miR-642b	CLIP-seq
MIRT2380362	hsa-miR-876-5p	CLIP-seq
MIRT1533989	hsa-miR-922	CLIP-seq
MIRT2672395	hsa-miR-1264	CLIP-seq
MIRT1533955	hsa-miR-3117-5p	CLIP-seq
MIRT1533956	hsa-miR-3129-3p	CLIP-seq
MIRT2672396	hsa-miR-329	CLIP-seq
MIRT1533960	hsa-miR-335	CLIP-seq
MIRT2672397	hsa-miR-362-3p	CLIP-seq
MIRT1533964	hsa-miR-3689a-3p	CLIP-seq
MIRT1533965	hsa-miR-3689c	CLIP-seq
MIRT2672398	hsa-miR-3941	CLIP-seq
MIRT1533969	hsa-miR-4460	CLIP-seq
MIRT2672399	hsa-miR-4503	CLIP-seq
MIRT2672400	hsa-miR-466	CLIP-seq
MIRT2672401	hsa-miR-4672	CLIP-seq
MIRT1533973	hsa-miR-4727-3p	CLIP-seq
MIRT1533974	hsa-miR-4728-5p	CLIP-seq
MIRT1533975	hsa-miR-4735-5p	CLIP-seq
MIRT2672402	hsa-miR-603	CLIP-seq
MIRT1533992	hsa-miR-938	CLIP-seq

Show/Hide all (9)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0003677	Function	DNA binding	IBA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	NAS	34673265
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q8IZM8

Protein name

Zinc finger protein 654 (Melanoma-associated antigen)

Protein function

May be involved in transcriptional regulation.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00096	zf-C2H2	25 → 47	Zinc finger, C2H2 type	Domain

Sequence

MLCNKEFLGGHIVRHAQAHQKKGSFACVICGRKFRNRGLMQKHLKNHVKKIQRQQIAAAQ
QDDQEVTALEEINCSSSSISFENGNSDSKDLEVETLTASSEGNKEVIPEHVAEFIEIPIS
VPEDVIENVIENGSPNNSLNNVFKPLTECGDDYEEEEDEEGDYEEDDYDLNQETSVIHKI
NGTVCHPKDIYATDQEGNFKCPALGCVRIFKRIGFLNKHAMTVHPTDLNVRQTVMKWSKG
KCKFCQRQFEDSQHFIDHLNRHSYPNVYFCLHFNCNESFKLPFQLAQHTKSHRIFQAQCS
FPECHELFEDLPLLYEHEAQHYLSKTPESSAQPSETILWDVQTDSNPNQEKDSSSNEKQT
ISLPVSTSKSRKESTEPKTCIESMEKKTDSLVQNGNERSDDTVSNISLIDQKMPDIEPNS
ENNCSSSDIVNGHSEIEQTPLVSSDPALKIDTNRIRTENGSILPSVVPQEHNTLPVSQAP
SKPNLTSEHTSYGLILTKPYVRPLPPSYLDERYLSMPKRRKFLTDRVDACSDQDNVYKKS
VKRLRCGKCLTTYCNAEALEAHLAQKKCQTLFGFDSDDESA

Sequence length

581

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (53)

Disease Name	Disease (Merged)	Source	PMID	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	27519286	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	16364760	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20348248, 21264495, 21618523, 23064813, 28486273, 31516568	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	16082588, 22213302	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	16364760	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	25400753	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	17208331, 22213302, 28638445	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	22287745	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	20648585, 21574154, 25743330	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	24147998, 31124967, 31155488	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	24147998, 31155488	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	31287009	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	12944987	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	12944987	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	11406556, 30064232	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	29311018	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	21951605	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	25400753, 25900108, 30302801	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma of uterus	Leiomyosarcoma Of Uterus	BEFREE	31209257	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liposarcoma, Myxoid	liposarcoma	BEFREE	30881511	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	16082588, 24068544, 31232474, 31838274	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	16082588	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	29311018	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20348248, 21264495, 21618523, 23064813, 28486273, 31516568	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	24147998, 31155488	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	17208331, 22138038, 22213302, 26717042, 28638445	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	19347865	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	31287009	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	17611652, 26868260, 31704814	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of testis	Malignant Neoplasm Of Testis	BEFREE	18323790, 22826471, 24509169, 26641256, 30498011, 30881511	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	17699848	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	16364760	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11238304, 21574154, 23564824, 26868260, 27121989, 27636589, 28454298, 28809608, 28814733, 29928403, 31217903	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	22287745	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	10746555, 11121145, 11449353, 14618628, 15305155, 1674672, 18323790, 1861072, 18831916, 19152070, 2066358, 25027754	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myxoid/Round Cell Liposarcoma	Myxoid Liposarcoma	BEFREE	30881511	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10884427, 12237889, 17208331, 21618523, 23564824, 27519286, 28641561, 30952725, 31135600, 31209257, 31217903	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	17208331, 22138038, 23124547, 27519286, 28454298, 29805617, 31384932	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	31287009	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	23564824	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prader-Willi Syndrome	Prader-Willi Syndrome	BEFREE	21912643	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	30881511	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	27519286	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	27362547, 28653599, 30197348, 31155488, 31169876, 31704827	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	30952725	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	25900108	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	26868260, 31704814	★★★★★ ★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	22287745, 30881511	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	17699848	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	17699848	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	26639233, 28415749	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	30790015	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	1339263	★★★★★ ★☆☆☆☆ Found in Text Mining only

ZNF654 (zinc finger protein 654)