Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5526
Gene name	Protein phosphatase 2 regulatory subunit B'beta
Gene symbol	PPP2R5B
Synonyms (NCBI Gene)	B56BB56betaPR61B
Chromosome	11
Chromosome location	11q13.1
Summary	The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common het

121

Show/Hide all (121)

miRTarBase ID	miRNA	Experiments
MIRT1257980	hsa-miR-1197	CLIP-seq
MIRT1257981	hsa-miR-1237	CLIP-seq
MIRT1257982	hsa-miR-1257	CLIP-seq
MIRT1257983	hsa-miR-216b	CLIP-seq
MIRT1257984	hsa-miR-3127-3p	CLIP-seq
MIRT1257985	hsa-miR-3152-5p	CLIP-seq
MIRT1257986	hsa-miR-3679-3p	CLIP-seq
MIRT1257987	hsa-miR-4279	CLIP-seq
MIRT1257988	hsa-miR-4303	CLIP-seq
MIRT1257989	hsa-miR-4317	CLIP-seq
MIRT1257990	hsa-miR-4436a	CLIP-seq
MIRT1257991	hsa-miR-4446-5p	CLIP-seq
MIRT1257992	hsa-miR-4649-3p	CLIP-seq
MIRT1257993	hsa-miR-629	CLIP-seq
MIRT1257981	hsa-miR-1237	CLIP-seq
MIRT1257984	hsa-miR-3127-3p	CLIP-seq
MIRT1257986	hsa-miR-3679-3p	CLIP-seq
MIRT1257988	hsa-miR-4303	CLIP-seq
MIRT1257991	hsa-miR-4446-5p	CLIP-seq
MIRT1257992	hsa-miR-4649-3p	CLIP-seq
MIRT1257993	hsa-miR-629	CLIP-seq
MIRT2302617	hsa-miR-3121-3p	CLIP-seq
MIRT2302618	hsa-miR-4649-5p	CLIP-seq
MIRT2302619	hsa-miR-591	CLIP-seq
MIRT2599218	hsa-miR-1179	CLIP-seq
MIRT2599219	hsa-miR-1207-5p	CLIP-seq
MIRT2599220	hsa-miR-122	CLIP-seq
MIRT2599221	hsa-miR-1267	CLIP-seq
MIRT2599222	hsa-miR-1285	CLIP-seq
MIRT2599223	hsa-miR-1289	CLIP-seq
MIRT2599224	hsa-miR-1321	CLIP-seq
MIRT2599225	hsa-miR-1587	CLIP-seq
MIRT1257985	hsa-miR-3152-5p	CLIP-seq
MIRT2599226	hsa-miR-3184	CLIP-seq
MIRT2599227	hsa-miR-3187-5p	CLIP-seq
MIRT2599228	hsa-miR-3202	CLIP-seq
MIRT2599229	hsa-miR-320a	CLIP-seq
MIRT2599230	hsa-miR-320b	CLIP-seq
MIRT2599231	hsa-miR-320c	CLIP-seq
MIRT2599232	hsa-miR-320d	CLIP-seq
MIRT2599233	hsa-miR-320e	CLIP-seq
MIRT2599234	hsa-miR-326	CLIP-seq
MIRT2599235	hsa-miR-330-5p	CLIP-seq
MIRT2599236	hsa-miR-361-3p	CLIP-seq
MIRT2599237	hsa-miR-378g	CLIP-seq
MIRT2599238	hsa-miR-423-5p	CLIP-seq
MIRT2599239	hsa-miR-4270	CLIP-seq
MIRT1257987	hsa-miR-4279	CLIP-seq
MIRT1257989	hsa-miR-4317	CLIP-seq
MIRT2599240	hsa-miR-4423-5p	CLIP-seq
MIRT2599241	hsa-miR-4429	CLIP-seq
MIRT2599242	hsa-miR-4441	CLIP-seq
MIRT2599243	hsa-miR-4480	CLIP-seq
MIRT2599244	hsa-miR-4492	CLIP-seq
MIRT2599245	hsa-miR-4498	CLIP-seq
MIRT2599246	hsa-miR-4505	CLIP-seq
MIRT2599247	hsa-miR-4652-3p	CLIP-seq
MIRT2599248	hsa-miR-4656	CLIP-seq
MIRT2599249	hsa-miR-4663	CLIP-seq
MIRT2599250	hsa-miR-4675	CLIP-seq
MIRT2599251	hsa-miR-4739	CLIP-seq
MIRT2599252	hsa-miR-4741	CLIP-seq
MIRT2599253	hsa-miR-4747-5p	CLIP-seq
MIRT2599254	hsa-miR-4756-5p	CLIP-seq
MIRT2599255	hsa-miR-4763-3p	CLIP-seq
MIRT2599256	hsa-miR-4778-5p	CLIP-seq
MIRT2599257	hsa-miR-4786-3p	CLIP-seq
MIRT2599258	hsa-miR-574-5p	CLIP-seq
MIRT2599259	hsa-miR-612	CLIP-seq
MIRT2599260	hsa-miR-648	CLIP-seq
MIRT2599261	hsa-miR-762	CLIP-seq
MIRT2599262	hsa-miR-765	CLIP-seq
MIRT2599218	hsa-miR-1179	CLIP-seq
MIRT2599220	hsa-miR-122	CLIP-seq
MIRT2599221	hsa-miR-1267	CLIP-seq
MIRT2599222	hsa-miR-1285	CLIP-seq
MIRT2599224	hsa-miR-1321	CLIP-seq
MIRT2599225	hsa-miR-1587	CLIP-seq
MIRT2688463	hsa-miR-296-5p	CLIP-seq
MIRT1257985	hsa-miR-3152-5p	CLIP-seq
MIRT2599226	hsa-miR-3184	CLIP-seq
MIRT2599227	hsa-miR-3187-5p	CLIP-seq
MIRT2599228	hsa-miR-3202	CLIP-seq
MIRT2599229	hsa-miR-320a	CLIP-seq
MIRT2599230	hsa-miR-320b	CLIP-seq
MIRT2599231	hsa-miR-320c	CLIP-seq
MIRT2599232	hsa-miR-320d	CLIP-seq
MIRT2599233	hsa-miR-320e	CLIP-seq
MIRT2599234	hsa-miR-326	CLIP-seq
MIRT2599235	hsa-miR-330-5p	CLIP-seq
MIRT2688464	hsa-miR-331-3p	CLIP-seq
MIRT2599236	hsa-miR-361-3p	CLIP-seq
MIRT2688465	hsa-miR-3690	CLIP-seq
MIRT2599237	hsa-miR-378g	CLIP-seq
MIRT2599238	hsa-miR-423-5p	CLIP-seq
MIRT1257987	hsa-miR-4279	CLIP-seq
MIRT2688466	hsa-miR-4308	CLIP-seq
MIRT1257989	hsa-miR-4317	CLIP-seq
MIRT2599240	hsa-miR-4423-5p	CLIP-seq
MIRT2599241	hsa-miR-4429	CLIP-seq
MIRT2599243	hsa-miR-4480	CLIP-seq
MIRT2688467	hsa-miR-4486	CLIP-seq
MIRT2599244	hsa-miR-4492	CLIP-seq
MIRT2599245	hsa-miR-4498	CLIP-seq
MIRT2688468	hsa-miR-4520a-3p	CLIP-seq
MIRT2688469	hsa-miR-4638-3p	CLIP-seq
MIRT2599247	hsa-miR-4652-3p	CLIP-seq
MIRT2599248	hsa-miR-4656	CLIP-seq
MIRT2599249	hsa-miR-4663	CLIP-seq
MIRT2599250	hsa-miR-4675	CLIP-seq
MIRT2599251	hsa-miR-4739	CLIP-seq
MIRT2599252	hsa-miR-4741	CLIP-seq
MIRT2599253	hsa-miR-4747-5p	CLIP-seq
MIRT2599254	hsa-miR-4756-5p	CLIP-seq
MIRT2688470	hsa-miR-4768-5p	CLIP-seq
MIRT2599256	hsa-miR-4778-5p	CLIP-seq
MIRT2599258	hsa-miR-574-5p	CLIP-seq
MIRT2599259	hsa-miR-612	CLIP-seq
MIRT2599260	hsa-miR-648	CLIP-seq
MIRT2599261	hsa-miR-762	CLIP-seq
MIRT2599262	hsa-miR-765	CLIP-seq

Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000159	Component	Protein phosphatase type 2A complex	IBA
GO:0000159	Component	Protein phosphatase type 2A complex	IEA
GO:0005515	Function	Protein binding	IPI	7592815, 15380617, 16456541, 18782753, 27880917, 28330616, 30595372, 32296183, 33961781, 35271311
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	8703017
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0010976	Process	Positive regulation of neuron projection development	IEA
GO:0019888	Function	Protein phosphatase regulator activity	IEA
GO:0019888	Function	Protein phosphatase regulator activity	TAS	8703017
GO:0031334	Process	Positive regulation of protein-containing complex assembly	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0051388	Process	Positive regulation of neurotrophin TRK receptor signaling pathway	IEA
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0070317	Process	Negative regulation of G0 to G1 transition	IEA
GO:0071363	Process	Cellular response to growth factor stimulus	IEA
GO:0072542	Function	Protein phosphatase activator activity	IBA

MIM	HGNC	e!Ensembl
601644	9310	ENSG00000068971

Q15173

Protein name

Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit beta isoform (PP2A B subunit isoform B'-beta) (PP2A B subunit isoform B56-beta) (PP2A B subunit isoform PR61-beta) (PP2A B subunit isoform R5-beta)

Protein function

As the regulatory component of the serine/threonine-protein phosphatase 2A (PP2A) holoenzyme, modulates substrate specificity, subcellular localization, and responsiveness to phosphorylation. The phosphorylated form mediates the interaction betw

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01603	B56	62 → 467	Protein phosphatase 2A regulatory B subunit (B56 family)	Family

Tissue specificity

TISSUE SPECIFICITY: Highest expression in brain.

Sequence

METKLPPASTPTSPSSPGLSPVPPPDKVDGFSRRSLRRARPRRSHSSSQFRYQSNQQELT
PLPLLKDVPASELHELLSRKLAQCGVMFDFLDCVADLKGKEVKRAALNELVECVGSTRGV
LIEPVYPDIIRMISVNIFRTLPPSENPEFDPEEDEPNLEPSWPHLQLVYEFFLRFLESPD
FQPSVAKRYVDQKFVLMLLELFDSEDPREREYLKTILHRVYGKFLGLRAYIRKQCNHIFL
RFIYEFEHFNGVAELLEILGSIINGFALPLKTEHKQFLVRVLIPLHSVKSLSVFHAQLAY
CVVQFLEKDATLTEHVIRGLLKYWPKTCTQKEVMFLGEMEEILDVIEPSQFVKIQEPLFK
QVARCVSSPHFQVAERALYFWNNEYILSLIEDNCHTVLPAVFGTLYQVSKEHWNQTIVSL
IYNVLKTFMEMNGKLFDELTASYKLEKQQEQQKAQERQELWQGLEELRLRRLQGTQGAKE
APLQRLTPQVAASGGQS

Sequence length

497

Interactions

View interactions

	KEGG		Reactome
	mRNA surveillance pathway Sphingolipid signaling pathway Cell cycle Oocyte meiosis PI3K-Akt signaling pathway AMPK signaling pathway Adrenergic signaling in cardiomyocytes T cell receptor signaling pathway Dopaminergic synapse Human papillomavirus infection		Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal Degradation of beta-catenin by the destruction complex Beta-catenin phosphorylation cascade Separation of Sister Chromatids Resolution of Sister Chromatid Cohesion XBP1(S) activates chaperone genes CTLA4 inhibitory signaling Platelet sensitization by LDL Disassembly of the destruction complex and recruitment of AXIN to the membrane Misspliced GSK3beta mutants stabilize beta-catenin S33 mutants of beta-catenin aren't phosphorylated S37 mutants of beta-catenin aren't phosphorylated S45 mutants of beta-catenin aren't phosphorylated T41 mutants of beta-catenin aren't phosphorylated APC truncation mutants have impaired AXIN binding AXIN missense mutants destabilize the destruction complex Truncations of AMER1 destabilize the destruction complex RHO GTPases Activate Formins RAF activation Negative regulation of MAPK pathway PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling Mitotic Prometaphase EML4 and NUDC in mitotic spindle formation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Adrenocortical carcinoma, hereditary	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PPP2R5B-related disorder	Benign; Likely benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (5)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	33712023, 36028814, 37923899	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	27521959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	26164757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	17187232		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia Type 1	Multiple Endocrine Neoplasia	BEFREE	9272177		★★★★★ ★☆☆☆☆ Found in Text Mining only

PPP2R5B (protein phosphatase 2 regulatory subunit B'beta)