Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	55256
Gene name	Acireductone dioxygenase 1
Gene symbol	ADI1
Synonyms (NCBI Gene)	APL1ARDARD'Fe-ARDHMFT1638MTCBP1Ni-ARDSIPLmtnD
Chromosome	2
Chromosome location	2p25.3
Summary	This gene encodes an enzyme that belongs to the aci-reductone dioxygenase family of metal-binding enzymes, which are involved in methionine salvage. This enzyme may regulate mRNA processing in the nucleus, and may carry out different functions depending o

132

Show/Hide all (132)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016389	hsa-miR-193b-3p	Proteomics	21512034
MIRT029129	hsa-miR-26b-5p	Microarray	19088304
MIRT723437	hsa-miR-6816-3p	HITS-CLIP	19536157
MIRT302584	hsa-miR-142-5p	HITS-CLIP	19536157
MIRT302608	hsa-miR-5590-3p	HITS-CLIP	19536157
MIRT723436	hsa-miR-4778-3p	HITS-CLIP	19536157
MIRT723435	hsa-miR-711	HITS-CLIP	19536157
MIRT723434	hsa-miR-340-5p	HITS-CLIP	19536157
MIRT723437	hsa-miR-6816-3p	HITS-CLIP	19536157
MIRT302584	hsa-miR-142-5p	HITS-CLIP	19536157
MIRT302608	hsa-miR-5590-3p	HITS-CLIP	19536157
MIRT723436	hsa-miR-4778-3p	HITS-CLIP	19536157
MIRT723435	hsa-miR-711	HITS-CLIP	19536157
MIRT723434	hsa-miR-340-5p	HITS-CLIP	19536157
MIRT768738	hsa-miR-1236	CLIP-seq
MIRT768739	hsa-miR-124	CLIP-seq
MIRT768740	hsa-miR-1302	CLIP-seq
MIRT768741	hsa-miR-2682	CLIP-seq
MIRT768742	hsa-miR-3065-3p	CLIP-seq
MIRT768743	hsa-miR-3122	CLIP-seq
MIRT768744	hsa-miR-3140-5p	CLIP-seq
MIRT768745	hsa-miR-3145-5p	CLIP-seq
MIRT768746	hsa-miR-3160-5p	CLIP-seq
MIRT768747	hsa-miR-3162-3p	CLIP-seq
MIRT768748	hsa-miR-3199	CLIP-seq
MIRT768749	hsa-miR-3671	CLIP-seq
MIRT768750	hsa-miR-3679-3p	CLIP-seq
MIRT768751	hsa-miR-3691-3p	CLIP-seq
MIRT768752	hsa-miR-3714	CLIP-seq
MIRT768753	hsa-miR-3910	CLIP-seq
MIRT768754	hsa-miR-3913-5p	CLIP-seq
MIRT768755	hsa-miR-3918	CLIP-seq
MIRT768756	hsa-miR-4286	CLIP-seq
MIRT768757	hsa-miR-4298	CLIP-seq
MIRT768758	hsa-miR-4300	CLIP-seq
MIRT768759	hsa-miR-4302	CLIP-seq
MIRT768760	hsa-miR-4427	CLIP-seq
MIRT768761	hsa-miR-449c	CLIP-seq
MIRT768762	hsa-miR-4522	CLIP-seq
MIRT768763	hsa-miR-4749-3p	CLIP-seq
MIRT768764	hsa-miR-4762-3p	CLIP-seq
MIRT768765	hsa-miR-4764-3p	CLIP-seq
MIRT768766	hsa-miR-4777-5p	CLIP-seq
MIRT768767	hsa-miR-4778-5p	CLIP-seq
MIRT768768	hsa-miR-4795-5p	CLIP-seq
MIRT768769	hsa-miR-496	CLIP-seq
MIRT768770	hsa-miR-501-5p	CLIP-seq
MIRT768771	hsa-miR-506	CLIP-seq
MIRT768772	hsa-miR-518d-5p	CLIP-seq
MIRT768773	hsa-miR-519b-5p	CLIP-seq
MIRT768774	hsa-miR-519c-5p	CLIP-seq
MIRT768775	hsa-miR-520c-5p	CLIP-seq
MIRT768776	hsa-miR-520d-5p	CLIP-seq
MIRT768777	hsa-miR-524-5p	CLIP-seq
MIRT768778	hsa-miR-526a	CLIP-seq
MIRT768779	hsa-miR-548ag	CLIP-seq
MIRT768780	hsa-miR-548ai	CLIP-seq
MIRT768781	hsa-miR-579	CLIP-seq
MIRT768782	hsa-miR-920	CLIP-seq
MIRT768783	hsa-miR-935	CLIP-seq
MIRT768739	hsa-miR-124	CLIP-seq
MIRT1926710	hsa-miR-1248	CLIP-seq
MIRT1926711	hsa-miR-183	CLIP-seq
MIRT1926712	hsa-miR-198	CLIP-seq
MIRT1926713	hsa-miR-2110	CLIP-seq
MIRT1926714	hsa-miR-217	CLIP-seq
MIRT768741	hsa-miR-2682	CLIP-seq
MIRT1926715	hsa-miR-3144-5p	CLIP-seq
MIRT1926716	hsa-miR-3150a-3p	CLIP-seq
MIRT1926717	hsa-miR-3159	CLIP-seq
MIRT1926718	hsa-miR-3173-5p	CLIP-seq
MIRT1926719	hsa-miR-3191	CLIP-seq
MIRT1926720	hsa-miR-3649	CLIP-seq
MIRT768752	hsa-miR-3714	CLIP-seq
MIRT768753	hsa-miR-3910	CLIP-seq
MIRT1926721	hsa-miR-3945	CLIP-seq
MIRT1926722	hsa-miR-4253	CLIP-seq
MIRT1926723	hsa-miR-4264	CLIP-seq
MIRT768759	hsa-miR-4302	CLIP-seq
MIRT1926724	hsa-miR-4479	CLIP-seq
MIRT768761	hsa-miR-449c	CLIP-seq
MIRT1926725	hsa-miR-4521	CLIP-seq
MIRT1926726	hsa-miR-4652-5p	CLIP-seq
MIRT1926727	hsa-miR-4704-3p	CLIP-seq
MIRT768763	hsa-miR-4749-3p	CLIP-seq
MIRT768768	hsa-miR-4795-5p	CLIP-seq
MIRT768771	hsa-miR-506	CLIP-seq
MIRT1926728	hsa-miR-544	CLIP-seq
MIRT1926729	hsa-miR-600	CLIP-seq
MIRT1926730	hsa-miR-602	CLIP-seq
MIRT1926731	hsa-miR-767-3p	CLIP-seq
MIRT768783	hsa-miR-935	CLIP-seq
MIRT1926712	hsa-miR-198	CLIP-seq
MIRT1926724	hsa-miR-4479	CLIP-seq
MIRT1926712	hsa-miR-198	CLIP-seq
MIRT1926714	hsa-miR-217	CLIP-seq
MIRT768746	hsa-miR-3160-5p	CLIP-seq
MIRT2470372	hsa-miR-3646	CLIP-seq
MIRT2470373	hsa-miR-3662	CLIP-seq
MIRT768751	hsa-miR-3691-3p	CLIP-seq
MIRT768755	hsa-miR-3918	CLIP-seq
MIRT1926721	hsa-miR-3945	CLIP-seq
MIRT1926722	hsa-miR-4253	CLIP-seq
MIRT2470374	hsa-miR-4424	CLIP-seq
MIRT1926724	hsa-miR-4479	CLIP-seq
MIRT1926725	hsa-miR-4521	CLIP-seq
MIRT768762	hsa-miR-4522	CLIP-seq
MIRT768766	hsa-miR-4777-5p	CLIP-seq
MIRT2470375	hsa-miR-493	CLIP-seq
MIRT768772	hsa-miR-518d-5p	CLIP-seq
MIRT768773	hsa-miR-519b-5p	CLIP-seq
MIRT768774	hsa-miR-519c-5p	CLIP-seq
MIRT768775	hsa-miR-520c-5p	CLIP-seq
MIRT768778	hsa-miR-526a	CLIP-seq
MIRT1926730	hsa-miR-602	CLIP-seq
MIRT2674600	hsa-miR-143	CLIP-seq
MIRT1926712	hsa-miR-198	CLIP-seq
MIRT1926714	hsa-miR-217	CLIP-seq
MIRT2470372	hsa-miR-3646	CLIP-seq
MIRT2470373	hsa-miR-3662	CLIP-seq
MIRT768755	hsa-miR-3918	CLIP-seq
MIRT1926721	hsa-miR-3945	CLIP-seq
MIRT1926722	hsa-miR-4253	CLIP-seq
MIRT2470374	hsa-miR-4424	CLIP-seq
MIRT1926724	hsa-miR-4479	CLIP-seq
MIRT1926725	hsa-miR-4521	CLIP-seq
MIRT768762	hsa-miR-4522	CLIP-seq
MIRT2674601	hsa-miR-4738-3p	CLIP-seq
MIRT2674602	hsa-miR-4770	CLIP-seq
MIRT2470375	hsa-miR-493	CLIP-seq
MIRT768781	hsa-miR-579	CLIP-seq
MIRT1926730	hsa-miR-602	CLIP-seq

Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005506	Function	Iron ion binding	IEA
GO:0005515	Function	Protein binding	IPI	14718544, 32296183
GO:0005634	Component	Nucleus	IDA	11602742, 14718544
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IDA	11602742, 14718544
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA	14718544
GO:0005886	Component	Plasma membrane	IEA
GO:0006555	Process	Methionine metabolic process	IBA
GO:0008652	Process	Amino acid biosynthetic process	IEA
GO:0009086	Process	Methionine biosynthetic process	IEA
GO:0010308	Function	Acireductone dioxygenase (Ni2+-requiring) activity	IEA
GO:0010309	Function	Acireductone dioxygenase [iron(II)-requiring] activity	IBA
GO:0010309	Function	Acireductone dioxygenase [iron(II)-requiring] activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0016151	Function	Nickel cation binding	IEA
GO:0016491	Function	Oxidoreductase activity	IDA	15938715
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0019509	Process	L-methionine salvage from methylthioadenosine	IDA	15938715
GO:0019509	Process	L-methionine salvage from methylthioadenosine	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051213	Function	Dioxygenase activity	IEA

MIM	HGNC	e!Ensembl
613400	30576	ENSG00000182551

Q9BV57

Protein name

Acireductone dioxygenase (Acireductone dioxygenase (Fe(2+)-requiring)) (ARD') (Fe-ARD) (EC 1.13.11.54) (Acireductone dioxygenase (Ni(2+)-requiring)) (ARD) (Ni-ARD) (EC 1.13.11.53) (Membrane-type 1 matrix metalloproteinase cytoplasmic tail-binding protein

Protein function

Catalyzes 2 different reactions between oxygen and the acireductone 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene) depending upon the metal bound in the active site (By similarity). Fe-containing acireductone dioxygenase (Fe-ARD) produces

PDB

4QGN , 7JXG

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03079	ARD	3 → 157		Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in heart, colon, lung, stomach, brain, spleen, liver, skeletal muscle and kidney. {ECO:0000269|PubMed:11602742, ECO:0000269|PubMed:14718544}.

Sequence

MVQAWYMDDAPGDPRQPHRPDPGRPVGLEQLRRLGVLYWKLDADKYENDPELEKIRRERN
YSWMDIITICKDKLPNYEEKIKMFYEEHLHLDDEIRYILDGSGYFDVRDKEDQWIRIFME
KGDMVTLPAGIYHRFTVDEKNYTKAMRLFVGEPVWTAYNRPADHFEARGQYVKFLAQTA

Sequence length

179

Interactions

View interactions

	KEGG		Reactome
	Cysteine and methionine metabolism Metabolic pathways		Methionine salvage pathway

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (37)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Arthritis	Arthritis	BEFREE	27160252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	27241313	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrichia with Papular Lesions	Atrichia with papular lesions	Pubtator	17869066	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	36320054	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	25640948		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	25393378		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	30512100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	BEFREE	29486040		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	15108120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	36482994	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	27173257	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	BEFREE	17047361		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	25640948		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	25640948		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	30512100		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	36320054	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Calculi	Kidney stone	BEFREE	29677308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30858354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	30858354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	17786183, 30629437, 30858354, 31804827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17786183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17786183, 30629437, 30858354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrolithiasis	Nephrolithiasis	BEFREE	29677308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Atrophy, Hereditary, Leber	Hereditary Leber Optic Atrophy	BEFREE	16380918		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	30487181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	15108120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	29486040		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	15108120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	17786183, 30629437, 30858354, 31804827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	17786183		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	17786183		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17786183		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	17786183	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	17786183	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	24177275, 27160252, 28595106		★★★★★ ★☆☆☆☆ Found in Text Mining only
SPONDYLOCARPOTARSAL SYNOSTOSIS SYNDROME	Spondylocarpotarsal Synostosis Syndrome	BEFREE	25393378		★★★★★ ★☆☆☆☆ Found in Text Mining only
Varicosity	Vulval varices	BEFREE	29486040		★★★★★ ★☆☆☆☆ Found in Text Mining only

ADI1 (acireductone dioxygenase 1)