Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	55254
Gene name	Transmembrane protein 39A
Gene symbol	TMEM39A
Synonyms (NCBI Gene)	SUSR2
Chromosome	3
Chromosome location	3q13.33

Show/Hide all (82)

miRTarBase ID	miRNA	Experiments	Reference
MIRT052363	hsa-let-7a-5p	CLASH	23622248
MIRT1436969	hsa-miR-1185	CLIP-seq
MIRT1436970	hsa-miR-299-3p	CLIP-seq
MIRT1436971	hsa-miR-3166	CLIP-seq
MIRT1436972	hsa-miR-3605-5p	CLIP-seq
MIRT1436973	hsa-miR-3616-3p	CLIP-seq
MIRT1436974	hsa-miR-3617	CLIP-seq
MIRT1436975	hsa-miR-3679-5p	CLIP-seq
MIRT1436976	hsa-miR-4265	CLIP-seq
MIRT1436977	hsa-miR-4296	CLIP-seq
MIRT1436978	hsa-miR-4322	CLIP-seq
MIRT1436979	hsa-miR-433	CLIP-seq
MIRT1436980	hsa-miR-4417	CLIP-seq
MIRT1436981	hsa-miR-4509	CLIP-seq
MIRT1436982	hsa-miR-4684-5p	CLIP-seq
MIRT1436983	hsa-miR-4721	CLIP-seq
MIRT1436984	hsa-miR-4744	CLIP-seq
MIRT1436985	hsa-miR-4760-5p	CLIP-seq
MIRT1436986	hsa-miR-4764-3p	CLIP-seq
MIRT1436987	hsa-miR-488	CLIP-seq
MIRT1436988	hsa-miR-641	CLIP-seq
MIRT2130990	hsa-miR-1207-3p	CLIP-seq
MIRT2130991	hsa-miR-1224-5p	CLIP-seq
MIRT2130992	hsa-miR-1305	CLIP-seq
MIRT2130993	hsa-miR-150	CLIP-seq
MIRT2130994	hsa-miR-3121-3p	CLIP-seq
MIRT2130995	hsa-miR-3673	CLIP-seq
MIRT2130996	hsa-miR-4639-3p	CLIP-seq
MIRT2130997	hsa-miR-4713-5p	CLIP-seq
MIRT2130998	hsa-miR-4714-3p	CLIP-seq
MIRT2130999	hsa-miR-4751	CLIP-seq
MIRT2131000	hsa-miR-532-3p	CLIP-seq
MIRT2131001	hsa-miR-890	CLIP-seq
MIRT2131002	hsa-miR-935	CLIP-seq
MIRT2130990	hsa-miR-1207-3p	CLIP-seq
MIRT2130991	hsa-miR-1224-5p	CLIP-seq
MIRT2352222	hsa-miR-200b	CLIP-seq
MIRT2352223	hsa-miR-200c	CLIP-seq
MIRT2352224	hsa-miR-429	CLIP-seq
MIRT2352225	hsa-miR-4445	CLIP-seq
MIRT2130999	hsa-miR-4751	CLIP-seq
MIRT2352226	hsa-miR-4803	CLIP-seq
MIRT2396009	hsa-miR-298	CLIP-seq
MIRT2396010	hsa-miR-4261	CLIP-seq
MIRT2396011	hsa-miR-4795-5p	CLIP-seq
MIRT2396012	hsa-miR-671-5p	CLIP-seq
MIRT2646017	hsa-miR-1236	CLIP-seq
MIRT2646018	hsa-miR-1323	CLIP-seq
MIRT2646019	hsa-miR-188-5p	CLIP-seq
MIRT2352222	hsa-miR-200b	CLIP-seq
MIRT2352223	hsa-miR-200c	CLIP-seq
MIRT2646020	hsa-miR-300	CLIP-seq
MIRT2646021	hsa-miR-381	CLIP-seq
MIRT2352224	hsa-miR-429	CLIP-seq
MIRT2646022	hsa-miR-4643	CLIP-seq
MIRT2646023	hsa-miR-4666-3p	CLIP-seq
MIRT2646024	hsa-miR-4788	CLIP-seq
MIRT2352226	hsa-miR-4803	CLIP-seq
MIRT2646025	hsa-miR-499-3p	CLIP-seq
MIRT2646026	hsa-miR-499a-3p	CLIP-seq
MIRT2646027	hsa-miR-548o	CLIP-seq
MIRT2646028	hsa-miR-550b	CLIP-seq
MIRT2646029	hsa-miR-607	CLIP-seq
MIRT2646030	hsa-miR-633	CLIP-seq
MIRT2646031	hsa-miR-889	CLIP-seq
MIRT2646017	hsa-miR-1236	CLIP-seq
MIRT2646018	hsa-miR-1323	CLIP-seq
MIRT2646019	hsa-miR-188-5p	CLIP-seq
MIRT2693519	hsa-miR-338-5p	CLIP-seq
MIRT2693520	hsa-miR-425	CLIP-seq
MIRT2646022	hsa-miR-4643	CLIP-seq
MIRT2646024	hsa-miR-4788	CLIP-seq
MIRT2352226	hsa-miR-4803	CLIP-seq
MIRT2646025	hsa-miR-499-3p	CLIP-seq
MIRT2646026	hsa-miR-499a-3p	CLIP-seq
MIRT2646027	hsa-miR-548o	CLIP-seq
MIRT2693521	hsa-miR-549	CLIP-seq
MIRT2646028	hsa-miR-550b	CLIP-seq
MIRT2693522	hsa-miR-570	CLIP-seq
MIRT2646029	hsa-miR-607	CLIP-seq
MIRT2646030	hsa-miR-633	CLIP-seq
MIRT2646031	hsa-miR-889	CLIP-seq

Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	31806350, 31849860
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IBA
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	31806350
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0006914	Process	Autophagy	IEA
GO:0016020	Component	Membrane	IEA
GO:0045070	Process	Positive regulation of viral genome replication	IDA	31849860
GO:1901097	Process	Negative regulation of autophagosome maturation	IBA
GO:1901097	Process	Negative regulation of autophagosome maturation	IMP	31806350
GO:1902902	Process	Negative regulation of autophagosome assembly	IBA
GO:1902902	Process	Negative regulation of autophagosome assembly	IMP	31806350

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q9NV64

Protein name

Transmembrane protein 39A

Protein function

Regulates autophagy by controlling the spatial distribution and levels of the intracellular phosphatidylinositol 4-phosphate (PtdIns(4)P) pools (PubMed:31806350). Modulates (PtdIns(4)P) levels by regulating the ER-to-Golgi trafficking of the pho

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10271	Tmp39	42 → 477	Putative transmembrane protein	Family

Tissue specificity

TISSUE SPECIFICITY: Up-regulated in brain tumor glioblastoma multiforme cells (at protein level). {ECO:0000269|PubMed:28133515}.

Sequence

MPGGRRGPSRQQLSRSALPSLQTLVGGGCGNGTGLRNRNGSAIGLPVPPITALITPGPVR
HCQIPDLPVDGSLLFEFLFFIYLLVALFIQYINIYKTVWWYPYNHPASCTSLNFHLIDYH
LAAFITVMLARRLVWALISEATKAGAASMIHYMVLISARLVLLTLCGWVLCWTLVNLFRS
HSVLNLLFLGYPFGVYVPLCCFHQDSRAHLLLTDYNYVVQHEAVEESASTVGGLAKSKDF
LSLLLESLKEQFNNATPIPTHSCPLSPDLIRNEVECLKADFNHRIKEVLFNSLFSAYYVA
FLPLCFVKSTQYYDMRWSCEHLIMVWINAFVMLTTQLLPSKYCDLLHKSAAHLGKWQKLE
HGSYSNAPQHIWSENTIWPQGVLVRHSRCLYRAMGPYNVAVPSDVSHARFYFLFHRPLRL
LNLLILIEGSVVFYQLYSLLRSEKWNHTLSMALILFCNYYVLFKLLRDRIVLGRAYSYPL
NSYELKAN

Sequence length

488

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BILIARY LIVER CIRRHOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY BILIARY CIRRHOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (12)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Autoimmune Diseases	Autoimmune Diseases	BEFREE	22194214, 31553233, 31806350		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	39237981	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	22464253	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	22464253, 25890262, 28427360	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	22464253, 25890262, 28427360		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	GWASCAT_DG	28714469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	20007504, 22194214		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	20007504	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	GWASDB_DG	21833088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	GWASDB_DG	21399635, 22961000		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Primary biliary cirrhosis	Biliary Cirrhosis	GWASCAT_DG	28425483		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

TMEM39A (transmembrane protein 39A)