Gene Gene information from NCBI Gene database.
Entrez ID 55246
Gene name Coiled-coil domain containing 25
Gene symbol CCDC25
Synonyms (NCBI Gene)
-
Chromosome 8
Chromosome location 8p21.1
miRNA miRNA information provided by mirtarbase database.
282
miRTarBase ID miRNA Experiments Reference
MIRT029529 hsa-miR-26b-5p Microarray 19088304
MIRT529176 hsa-miR-5003-3p PAR-CLIP 22012620
MIRT529175 hsa-miR-6501-3p PAR-CLIP 22012620
MIRT529174 hsa-miR-1250-3p PAR-CLIP 22012620
MIRT529173 hsa-miR-153-5p PAR-CLIP 22012620
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
9
GO ID Ontology Definition Evidence Reference
GO:0003677 Function DNA binding IDA 32528174
GO:0003677 Function DNA binding IEA
GO:0005515 Function Protein binding IPI 25416956, 32296183
GO:0005886 Component Plasma membrane IDA 32528174
GO:0005886 Component Plasma membrane IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
619100 25591 ENSG00000147419
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q86WR0
Protein name Coiled-coil domain-containing protein 25
Protein function Transmembrane receptor that senses neutrophil extracellular traps (NETs) and triggers the ILK-PARVB pathway to enhance cell motility (PubMed:32528174). NETs are mainly composed of DNA fibers and are released by neutrophils to bind pathogens duri
PDB 7EOE , 7EOF , 8WOH
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF05670 NFACT-R_1 1 113 NFACT protein RNA binding domain Domain
Sequence
MVFYFTSSSVNSSAYTIYMGKDKYENEDLIKHGWPEDIWFHVDKLSSAHVYLRLHKGENI
EDIPKEVLMDCAHLVKANSIQGCKMNNVNVVYTPWSNLKKTADMDVGQIGFHR
QKDVKIV
TVEKKVNEILNRLEKTKVERFPDLAAEKECRDREERNEKKAQIQEMKKREKEEMKKKREM
DELRSYSSLMKVENMSSNQDGNDSDEFM
Sequence length 208
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
INSOMNIA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Cholangiocarcinoma Cholangiocarcinoma BEFREE 28789463
★☆☆☆☆
Found in Text Mining only
Cholangiocarcinoma Cholangiocarcinoma Pubtator 34067437 Associate
★☆☆☆☆
Found in Text Mining only
Cholangiocarcinoma Cholangiocarcinoma Pubtator 36593058 Stimulate
★☆☆☆☆
Found in Text Mining only
Congenital contractural arachnodactyly Congenital Contractural Arachnodactyly BEFREE 28789463
★☆☆☆☆
Found in Text Mining only
Lymphatic Metastasis Lymphatic metastasis Pubtator 34067437 Associate
★☆☆☆☆
Found in Text Mining only
Schizophrenia Schizophrenia BEFREE 26851141
★☆☆☆☆
Found in Text Mining only