Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	55240
Gene name	STEAP3 metalloreductase
Gene symbol	STEAP3
Synonyms (NCBI Gene)	AHMIO2STMP3TSAP6dudlin-2dudulin-2pHyde
Chromosome	2
Chromosome location	2q14.2
Summary	This gene encodes a multipass membrane protein that functions as an iron transporter. The encoded protein can reduce both iron (Fe3+) and copper (Cu2+) cations. This protein may mediate downstream responses to p53, including promoting apoptosis. Deficienc

223

Show/Hide all (223)

miRTarBase ID	miRNA	Experiments	Reference
MIRT027494	hsa-miR-98-5p	Microarray	19088304
MIRT031486	hsa-miR-16-5p	Proteomics	18668040
MIRT052160	hsa-let-7b-5p	CLASH	23622248
MIRT049382	hsa-miR-92a-3p	CLASH	23622248
MIRT486983	hsa-miR-296-3p	PAR-CLIP	20371350
MIRT486982	hsa-miR-24-3p	PAR-CLIP	20371350
MIRT486981	hsa-miR-4437	PAR-CLIP	20371350
MIRT486980	hsa-miR-4283	PAR-CLIP	20371350
MIRT486979	hsa-miR-1237-5p	PAR-CLIP	20371350
MIRT486978	hsa-miR-4488	PAR-CLIP	20371350
MIRT486977	hsa-miR-4697-5p	PAR-CLIP	20371350
MIRT486976	hsa-miR-6846-5p	PAR-CLIP	20371350
MIRT486975	hsa-miR-6848-5p	PAR-CLIP	20371350
MIRT486974	hsa-miR-92a-1-5p	PAR-CLIP	20371350
MIRT486973	hsa-miR-1275	PAR-CLIP	20371350
MIRT486972	hsa-miR-4665-5p	PAR-CLIP	20371350
MIRT486971	hsa-miR-7109-5p	PAR-CLIP	20371350
MIRT486970	hsa-miR-6751-5p	PAR-CLIP	20371350
MIRT486969	hsa-miR-6803-5p	PAR-CLIP	20371350
MIRT512672	hsa-miR-3173-3p	PAR-CLIP	23446348
MIRT512671	hsa-miR-6891-5p	PAR-CLIP	23446348
MIRT512670	hsa-miR-5197-5p	PAR-CLIP	23446348
MIRT512669	hsa-miR-518c-5p	PAR-CLIP	23446348
MIRT512668	hsa-miR-875-3p	PAR-CLIP	23446348
MIRT512667	hsa-miR-6128	PAR-CLIP	23446348
MIRT512666	hsa-miR-7854-3p	PAR-CLIP	23446348
MIRT512665	hsa-miR-3689d	PAR-CLIP	23446348
MIRT512664	hsa-miR-6851-5p	PAR-CLIP	23446348
MIRT512663	hsa-miR-6822-3p	PAR-CLIP	23446348
MIRT512662	hsa-miR-760	PAR-CLIP	23446348
MIRT512661	hsa-miR-1299	PAR-CLIP	23446348
MIRT512660	hsa-miR-3978	PAR-CLIP	23446348
MIRT512659	hsa-miR-8057	PAR-CLIP	23446348
MIRT486983	hsa-miR-296-3p	PAR-CLIP	23592263
MIRT486982	hsa-miR-24-3p	PAR-CLIP	23592263
MIRT486981	hsa-miR-4437	PAR-CLIP	23592263
MIRT486980	hsa-miR-4283	PAR-CLIP	23592263
MIRT486979	hsa-miR-1237-5p	PAR-CLIP	23592263
MIRT486978	hsa-miR-4488	PAR-CLIP	23592263
MIRT486977	hsa-miR-4697-5p	PAR-CLIP	23592263
MIRT486976	hsa-miR-6846-5p	PAR-CLIP	23592263
MIRT486975	hsa-miR-6848-5p	PAR-CLIP	23592263
MIRT486974	hsa-miR-92a-1-5p	PAR-CLIP	23592263
MIRT486973	hsa-miR-1275	PAR-CLIP	23592263
MIRT486972	hsa-miR-4665-5p	PAR-CLIP	23592263
MIRT486971	hsa-miR-7109-5p	PAR-CLIP	23592263
MIRT486970	hsa-miR-6751-5p	PAR-CLIP	23592263
MIRT486969	hsa-miR-6803-5p	PAR-CLIP	23592263
MIRT486983	hsa-miR-296-3p	PAR-CLIP	20371350
MIRT486982	hsa-miR-24-3p	PAR-CLIP	20371350
MIRT486981	hsa-miR-4437	PAR-CLIP	20371350
MIRT486980	hsa-miR-4283	PAR-CLIP	20371350
MIRT486979	hsa-miR-1237-5p	PAR-CLIP	20371350
MIRT486978	hsa-miR-4488	PAR-CLIP	20371350
MIRT486977	hsa-miR-4697-5p	PAR-CLIP	20371350
MIRT486976	hsa-miR-6846-5p	PAR-CLIP	20371350
MIRT486975	hsa-miR-6848-5p	PAR-CLIP	20371350
MIRT486974	hsa-miR-92a-1-5p	PAR-CLIP	20371350
MIRT486973	hsa-miR-1275	PAR-CLIP	20371350
MIRT486972	hsa-miR-4665-5p	PAR-CLIP	20371350
MIRT486971	hsa-miR-7109-5p	PAR-CLIP	20371350
MIRT486970	hsa-miR-6751-5p	PAR-CLIP	20371350
MIRT486969	hsa-miR-6803-5p	PAR-CLIP	20371350
MIRT512672	hsa-miR-3173-3p	PAR-CLIP	23446348
MIRT512671	hsa-miR-6891-5p	PAR-CLIP	23446348
MIRT512670	hsa-miR-5197-5p	PAR-CLIP	23446348
MIRT512669	hsa-miR-518c-5p	PAR-CLIP	23446348
MIRT512668	hsa-miR-875-3p	PAR-CLIP	23446348
MIRT512667	hsa-miR-6128	PAR-CLIP	23446348
MIRT512666	hsa-miR-7854-3p	PAR-CLIP	23446348
MIRT512665	hsa-miR-3689d	PAR-CLIP	23446348
MIRT512664	hsa-miR-6851-5p	PAR-CLIP	23446348
MIRT512663	hsa-miR-6822-3p	PAR-CLIP	23446348
MIRT512662	hsa-miR-760	PAR-CLIP	23446348
MIRT512661	hsa-miR-1299	PAR-CLIP	23446348
MIRT512660	hsa-miR-3978	PAR-CLIP	23446348
MIRT512659	hsa-miR-8057	PAR-CLIP	23446348
MIRT486983	hsa-miR-296-3p	PAR-CLIP	23592263
MIRT486982	hsa-miR-24-3p	PAR-CLIP	23592263
MIRT486981	hsa-miR-4437	PAR-CLIP	23592263
MIRT486980	hsa-miR-4283	PAR-CLIP	23592263
MIRT486979	hsa-miR-1237-5p	PAR-CLIP	23592263
MIRT486978	hsa-miR-4488	PAR-CLIP	23592263
MIRT486977	hsa-miR-4697-5p	PAR-CLIP	23592263
MIRT486976	hsa-miR-6846-5p	PAR-CLIP	23592263
MIRT486975	hsa-miR-6848-5p	PAR-CLIP	23592263
MIRT486974	hsa-miR-92a-1-5p	PAR-CLIP	23592263
MIRT486973	hsa-miR-1275	PAR-CLIP	23592263
MIRT486972	hsa-miR-4665-5p	PAR-CLIP	23592263
MIRT486971	hsa-miR-7109-5p	PAR-CLIP	23592263
MIRT486970	hsa-miR-6751-5p	PAR-CLIP	23592263
MIRT486969	hsa-miR-6803-5p	PAR-CLIP	23592263
MIRT1396852	hsa-miR-124	CLIP-seq
MIRT1396853	hsa-miR-1253	CLIP-seq
MIRT1396854	hsa-miR-1273g	CLIP-seq
MIRT1396855	hsa-miR-128	CLIP-seq
MIRT1396856	hsa-miR-1280	CLIP-seq
MIRT1396857	hsa-miR-1289	CLIP-seq
MIRT1396858	hsa-miR-140-5p	CLIP-seq
MIRT1396859	hsa-miR-199a-5p	CLIP-seq
MIRT1396860	hsa-miR-199b-5p	CLIP-seq
MIRT1396861	hsa-miR-299-5p	CLIP-seq
MIRT1396862	hsa-miR-3127-5p	CLIP-seq
MIRT1396863	hsa-miR-3198	CLIP-seq
MIRT1396864	hsa-miR-345	CLIP-seq
MIRT1396865	hsa-miR-3909	CLIP-seq
MIRT1396866	hsa-miR-4256	CLIP-seq
MIRT1396867	hsa-miR-4270	CLIP-seq
MIRT1396868	hsa-miR-4294	CLIP-seq
MIRT1396869	hsa-miR-4302	CLIP-seq
MIRT1396870	hsa-miR-4309	CLIP-seq
MIRT1396871	hsa-miR-4314	CLIP-seq
MIRT1396872	hsa-miR-4441	CLIP-seq
MIRT1396873	hsa-miR-4514	CLIP-seq
MIRT1396874	hsa-miR-4655-5p	CLIP-seq
MIRT1396875	hsa-miR-4668-5p	CLIP-seq
MIRT1396876	hsa-miR-4676-5p	CLIP-seq
MIRT1396877	hsa-miR-4692	CLIP-seq
MIRT1396878	hsa-miR-4712-5p	CLIP-seq
MIRT1396879	hsa-miR-4727-5p	CLIP-seq
MIRT1396880	hsa-miR-4769-3p	CLIP-seq
MIRT1396881	hsa-miR-506	CLIP-seq
MIRT1396882	hsa-miR-548al	CLIP-seq
MIRT1396883	hsa-miR-575	CLIP-seq
MIRT1396884	hsa-miR-770-5p	CLIP-seq
MIRT1396885	hsa-miR-1293	CLIP-seq
MIRT1396886	hsa-miR-1343	CLIP-seq
MIRT1396887	hsa-miR-153	CLIP-seq
MIRT1396888	hsa-miR-27a	CLIP-seq
MIRT1396889	hsa-miR-27b	CLIP-seq
MIRT1396890	hsa-miR-299-3p	CLIP-seq
MIRT1396891	hsa-miR-302f	CLIP-seq
MIRT1396892	hsa-miR-3148	CLIP-seq
MIRT1396893	hsa-miR-3157-5p	CLIP-seq
MIRT1396894	hsa-miR-3165	CLIP-seq
MIRT1396895	hsa-miR-3192	CLIP-seq
MIRT1396896	hsa-miR-3622b-5p	CLIP-seq
MIRT1396897	hsa-miR-3667-3p	CLIP-seq
MIRT1396898	hsa-miR-3670	CLIP-seq
MIRT1396899	hsa-miR-3674	CLIP-seq
MIRT1396900	hsa-miR-412	CLIP-seq
MIRT1396901	hsa-miR-4257	CLIP-seq
MIRT1396902	hsa-miR-4269	CLIP-seq
MIRT1396903	hsa-miR-4271	CLIP-seq
MIRT1396904	hsa-miR-4297	CLIP-seq
MIRT1396905	hsa-miR-4464	CLIP-seq
MIRT1396906	hsa-miR-4483	CLIP-seq
MIRT1396907	hsa-miR-4491	CLIP-seq
MIRT1396908	hsa-miR-4645-5p	CLIP-seq
MIRT1396909	hsa-miR-4657	CLIP-seq
MIRT1396910	hsa-miR-4659a-3p	CLIP-seq
MIRT1396911	hsa-miR-4659b-3p	CLIP-seq
MIRT1396912	hsa-miR-4673	CLIP-seq
MIRT1396913	hsa-miR-4691-3p	CLIP-seq
MIRT1396914	hsa-miR-4725-3p	CLIP-seq
MIRT1396915	hsa-miR-4747-5p	CLIP-seq
MIRT1396916	hsa-miR-4748	CLIP-seq
MIRT1396917	hsa-miR-508-5p	CLIP-seq
MIRT1396918	hsa-miR-513a-5p	CLIP-seq
MIRT1396919	hsa-miR-518a-5p	CLIP-seq
MIRT1396920	hsa-miR-527	CLIP-seq
MIRT1396921	hsa-miR-556-5p	CLIP-seq
MIRT1396922	hsa-miR-670	CLIP-seq
MIRT1396923	hsa-miR-9	CLIP-seq
MIRT1396856	hsa-miR-1280	CLIP-seq
MIRT2341180	hsa-miR-1285	CLIP-seq
MIRT1396885	hsa-miR-1293	CLIP-seq
MIRT2341181	hsa-miR-1915	CLIP-seq
MIRT2341182	hsa-miR-3155	CLIP-seq
MIRT2341183	hsa-miR-3155b	CLIP-seq
MIRT1396893	hsa-miR-3157-5p	CLIP-seq
MIRT2341184	hsa-miR-3187-5p	CLIP-seq
MIRT2341185	hsa-miR-326	CLIP-seq
MIRT2341186	hsa-miR-330-5p	CLIP-seq
MIRT2341187	hsa-miR-3614-3p	CLIP-seq
MIRT2341188	hsa-miR-3663-3p	CLIP-seq
MIRT2341189	hsa-miR-371-5p	CLIP-seq
MIRT2341190	hsa-miR-378g	CLIP-seq
MIRT1396901	hsa-miR-4257	CLIP-seq
MIRT2341191	hsa-miR-4265	CLIP-seq
MIRT2341192	hsa-miR-4292	CLIP-seq
MIRT2341193	hsa-miR-4296	CLIP-seq
MIRT2341194	hsa-miR-4308	CLIP-seq
MIRT2341195	hsa-miR-4322	CLIP-seq
MIRT2341196	hsa-miR-4436b-3p	CLIP-seq
MIRT1396906	hsa-miR-4483	CLIP-seq
MIRT2341197	hsa-miR-4486	CLIP-seq
MIRT1396873	hsa-miR-4514	CLIP-seq
MIRT2341198	hsa-miR-4535	CLIP-seq
MIRT1396874	hsa-miR-4655-5p	CLIP-seq
MIRT1396876	hsa-miR-4676-5p	CLIP-seq
MIRT2341199	hsa-miR-4685-5p	CLIP-seq
MIRT1396913	hsa-miR-4691-3p	CLIP-seq
MIRT1396877	hsa-miR-4692	CLIP-seq
MIRT1396878	hsa-miR-4712-5p	CLIP-seq
MIRT2341200	hsa-miR-4768-5p	CLIP-seq
MIRT2341201	hsa-miR-4776-5p	CLIP-seq
MIRT2341202	hsa-miR-484	CLIP-seq
MIRT2341203	hsa-miR-492	CLIP-seq
MIRT2341204	hsa-miR-520a-5p	CLIP-seq
MIRT2341205	hsa-miR-525-5p	CLIP-seq
MIRT1396882	hsa-miR-548al	CLIP-seq
MIRT1396883	hsa-miR-575	CLIP-seq
MIRT2341206	hsa-miR-612	CLIP-seq
MIRT1396884	hsa-miR-770-5p	CLIP-seq
MIRT2395326	hsa-let-7a	CLIP-seq
MIRT2395327	hsa-let-7b	CLIP-seq
MIRT2395328	hsa-let-7c	CLIP-seq
MIRT2395329	hsa-let-7d	CLIP-seq
MIRT2395330	hsa-let-7e	CLIP-seq
MIRT2395331	hsa-let-7f	CLIP-seq
MIRT2395332	hsa-let-7g	CLIP-seq
MIRT2395333	hsa-let-7i	CLIP-seq
MIRT2395334	hsa-miR-1294	CLIP-seq
MIRT2395335	hsa-miR-202	CLIP-seq
MIRT2395336	hsa-miR-4299	CLIP-seq
MIRT2395337	hsa-miR-4458	CLIP-seq
MIRT2395338	hsa-miR-4500	CLIP-seq
MIRT2395339	hsa-miR-4519	CLIP-seq
MIRT2395340	hsa-miR-4710	CLIP-seq
MIRT2395341	hsa-miR-4792	CLIP-seq
MIRT2395342	hsa-miR-7	CLIP-seq
MIRT2395343	hsa-miR-98	CLIP-seq

Show/Hide all (24)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	22624035
GO:0005737	Component	Cytoplasm	IDA	25468996
GO:0005768	Component	Endosome	IBA
GO:0005768	Component	Endosome	IEA
GO:0005771	Component	Multivesicular body	IDA	15319436
GO:0005886	Component	Plasma membrane	IBA
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006826	Process	Iron ion transport	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0008823	Function	Cupric reductase (NADH) activity	IBA
GO:0009306	Process	Protein secretion	IDA	15319436
GO:0009306	Process	Protein secretion	IMP	22624035
GO:0010008	Component	Endosome membrane	IEA
GO:0010008	Component	Endosome membrane	ISS
GO:0010008	Component	Endosome membrane	TAS
GO:0015677	Process	Copper ion import	IBA
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0020037	Function	Heme binding	IDA	26205815
GO:0042802	Function	Identical protein binding	IPI	18495927
GO:0046872	Function	Metal ion binding	IEA
GO:0052851	Function	Ferric-chelate reductase (NADPH) activity	IBA
GO:0052851	Function	Ferric-chelate reductase (NADPH) activity	IDA	26205815
GO:0071949	Function	FAD binding	IDA	26205815

MIM	HGNC	e!Ensembl
609671	24592	ENSG00000115107

Q658P3

Protein name

Metalloreductase STEAP3 (EC 1.16.1.-) (Dudulin-2) (Six-transmembrane epithelial antigen of prostate 3) (Tumor suppressor-activated pathway protein 6) (hTSAP6) (pHyde) (hpHyde)

Protein function

Integral membrane protein that functions as a NADPH-dependent ferric-chelate reductase, using NADPH from one side of the membrane to reduce a Fe(3+) chelate that is bound on the other side of the membrane (PubMed:26205815). Mediates sequential t

PDB

2VNS , 2VQ3

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03807	F420_oxidored	30 → 117	NADP oxidoreductase coenzyme F420-dependent	Family
PF01794	Ferric_reduct	259 → 406	Ferric reductase like transmembrane component	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in adult bone marrow, placenta, liver, skeletal muscle and pancreas. Down-regulated in hepatocellular carcinoma. {ECO:0000269|PubMed:12606722, ECO:0000269|PubMed:15885357, ECO:0000269|PubMed:16227996}.

Sequence

MPEEMDKPLISLHLVDSDSSLAKVPDEAPKVGILGSGDFARSLATRLVGSGFKVVVGSRN
PKRTARLFPSAAQVTFQEEAVSSPEVIFVAVFREHYSSLCSLSDQLAGKILVDVSNPTEQ
EHLQHRESNAEYLASLFPTCTVVKAFNVISAWTLQAGPRDGNRQVPICGDQPEAKRAVSE
MALAMGFMPVDMGSLASAWEVEAMPLRLLPAWKVPTLLALGLFVCFYAYNFVRDVLQPYV
QESQNKFFKLPVSVVNTTLPCVAYVLLSLVYLPGVLAAALQLRRGTKYQRFPDWLDHWLQ
HRKQIGLLSFFCAALHALYSFCLPLRRAHRYDLVNLAVKQVLANKSHLWVEEEVWRMEIY
LSLGVLALGTLSLLAVTSLPSIANSLNWREFSFVQSSLGFVALVLSTLHTLTYGWTRAFE
ESRYKFYLPPTFTLTLLVPCVVILAKALFLLPCISRRLARIRRGWERESTIKFTLPTDHA
LAEKTSHV

Sequence length

488

Interactions

View interactions

	KEGG		Reactome
	p53 signaling pathway Ferroptosis		TP53 Regulates Transcription of Genes Involved in Cytochrome C Release Transferrin endocytosis and recycling

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANEMIA, HYPOCHROMIC MICROCYTIC, WITH IRON OVERLOAD	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANEMIA, HYPOCHROMIC MICROCYTIC, WITH IRON OVERLOAD 2	—	Disgenet, HPO Disgenet, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLON CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPEROPIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEWY BODY DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Severe congenital hypochromic anemia with ringed sideroblasts	no classifications from unflagged records	ClinVar ClinGen, ClinVar, Disgenet, GenCC, Orphanet ClinGen, ClinVar, Disgenet, GenCC, Orphanet ClinGen, ClinVar, Disgenet, GenCC, Orphanet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
SKIN DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STEAP3-related disorder	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (47)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	35500219	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	39394418	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia hypochromic microcytic	Hypochromic microcytic anemia	Pubtator	38360212	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Hypochromic Microcytic, With Iron Overload	Anemia	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANEMIA, HYPOCHROMIC MICROCYTIC, WITH IRON OVERLOAD 2	Anemia	GENOMICS_ENGLAND_DG	22031863		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANEMIA, HYPOCHROMIC MICROCYTIC, WITH IRON OVERLOAD 2	Anemia	ORPHANET_DG	22031863		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANEMIA, HYPOCHROMIC MICROCYTIC, WITH IRON OVERLOAD 2	Anemia	CLINVAR_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	Pubtator	37980651	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	35501667	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36495944	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33092599, 35275508	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	36424540, 37344930	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	35501667	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	36769209	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	15885357		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22420032		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	19603079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	19603079	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysplastic erythropoesis	Dysplastic erythropoesis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	36495944	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	34655361	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	29730475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	29730475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	27898674, 37980651	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	29730475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	37009153	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	36495944	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypochromic anemia	Hypochromic anemia	BEFREE	22031863		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypochromic anemia	Hypochromic anemia	GENOMICS_ENGLAND_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypogonadism	Hypogonadism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	40022042	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	36495944	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Iron-Refractory Iron Deficiency Anemia	Anemia	BEFREE	22031863		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	15885357, 28303916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	15885357		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	16024648, 19016247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcytic hypochromic anemia (disorder)	Anemia	BEFREE	18955558		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21871451, 22420032, 28303916, 29730475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	34075060	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	37386521	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	16024648, 19016247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	31393902, 35275508	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	GWASCAT_DG	31231134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe congenital hypochromic anemia with ringed sideroblasts	Severe Congenital Hypochromic Anemia With Ringed Sideroblasts	Orphanet			★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)

STEAP3 (STEAP3 metalloreductase)